Detailed information on CNT30475173


BLAST search results

BLAST vs Swiss-Prot:
sp|P18122|CATA1_MAIZE, E-value = 0.0

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673657Saccharum spontaneumSetaria viridis13.3241.0894.9599forward
CNT30640190Saccharum spontaneumNymphaea colorata27.1923.4679.21202forward
CNT30516671Saccharum spontaneumJuglans regia46.0373.0882.75342forward
CNT30377107Saccharum spontaneumArabidopsis thaliana39.9762.7979.8297forward
CNT30501026Saccharum spontaneumCoffea canephora31.6315.3981.28235forward
CNT30282683Saccharum spontaneumChenopodium quinoa45.6336.8179.65339forward
CNT3021611Saccharum spontaneumCitrullus lanatus45.2284.6382.14336forward
CNT30380803Saccharum spontaneumManihot esculenta32.8452.0380.33244forward
CNT30708912Saccharum spontaneumGlycine max32.0327.3279.83238forward
CNT3046375Saccharum spontaneumPrunus dulcis77.9382.9581.17579forward
CNT30168584Saccharum spontaneumPistacia vera28.6778.680.75213forward
CNT30638211Saccharum spontaneumCapsicum annuum15.2120.2583.19113forward
CNT3098566Saccharum spontaneumSolanum tuberosum16.023582.35119forward
CNT30305192Saccharum spontaneumTriticum aestivum72.4199.2688.85538forward
CNT30567580Saccharum spontaneumActinidia chinensis24.93783.24185forward
CNT3085325Saccharum spontaneumVigna radiata39.0341.0281.72290forward
CNT30668770Saccharum spontaneumTriticum dicoccoides99.1996.2188.6737forward
CNT30313019Saccharum spontaneumCamelina sativa35.2642.8183.21262forward
CNT3080335Saccharum spontaneumBrassica juncea27.7336.3382.52206forward
CNT30263082Saccharum spontaneumBrassica rapa40.1188.9683.56298forward
CNT30228948Saccharum spontaneumAnanas comosus8.3421.2387.162forward
CNT30654455Saccharum spontaneumRosa chinensis20.0532.683.89149forward
CNT30715065Saccharum spontaneumMalus domestica golden86.4145.1579.6642forward
CNT30624536Saccharum spontaneumDaucus carota43.4722.9981.42323forward
CNT30688530Saccharum spontaneumTriticum urartu32.356.691.67240forward
CNT30478285Saccharum spontaneumArabidopsis halleri2145.0983.33156forward
CNT30368538Saccharum spontaneumSorghum bicolor47.2458.596.3351forward
CNT30370393Saccharum spontaneumOryza glumipatula17.555.3290.77130forward
CNT30154060Saccharum spontaneumPrunus persica66.6249.379.8495forward
CNT30570453Saccharum spontaneumVitis vinifera1423.6983.65104forward
CNT30704833Saccharum spontaneumPrunus avium58.9561.3480.82438forward
CNT3022395Saccharum spontaneumPopulus trichocarpa31.4956.9385.47234forward
CNT3038372Saccharum spontaneumCucumis melo92.4662.4578.31687forward
CNT30576697Saccharum spontaneumOryza barthii49.1384.187.4365forward
CNT3050211Saccharum spontaneumCucumis sativus45.990.6980.06341forward

Expression of CNT30475173

Peptides detected in this lncRNA

>peptide 1 (67 aa)
MAVASASNSHSFIIKQAFHTTSRLPMEFHKVRLSIPVDQGVGIDTKALHVPVVEWDANIIEEEGEHV*

>peptide 2 (39 aa)
PFMVVVVVGTFWCIHRKHQIVWTKAVPLGISIGEDSRLE*

>peptide 3 (42 aa)
MFLFRTIRPTGCSGMISSGQVLVTSSGSKSNLFSCSRSIVWM*

>peptide 4 (39 aa)
MESYRSFVAWLWQVPPTVTASSSSKHFTPQVGFQWNFTR*

>peptide 5 (51 aa)
TLHGGCCGGHILVHSQEASDSLDQGGASGYQHRRRFSSGVAYHQNSGFQGQ*

Sequence

>CNT30475173
ACCCTTCATGGTGGTTGTTGTGGTGGGCACATTTTGGTGCATTCACAGGAAGCATCAGATAGTTTGGACCAAGGCGGTGCCTCTGGGTATCAGCATAGGA
GAAGATTCTCGTCTGGAGTAGCTTATCATCAGAATAGTGGATTCCAGGGACAATAATTGCTGGGCAGAAAGCAATTTGTTCATTCTCTGCAAAGAAGTTA
TCAATGTTCTTGTTCAGGACCATCCGTCCAACAGGTTGCAGCGGGATGATATCCTCAGGCCAGGTCTTGGTGACATCAAGCGGGTCAAAGTCGAACTTAT
TCTCATGCTCAAGATCAATAGTCTGGATGTAGAGCTTCCATTCAGGGTAATTCCCAGCTGCGATGGAATCATATAGATCCTTCGTCGCATGGCTGTGGCA
AGTGCCTCCAACAGTCACAGCTTCATCATCAAGCAAGCATTTCACACCACAAGTAGGCTTCCAATGGAATTTCACAAGGTGAGGCTTTCCATCCCTGTTG
ATCAAGGTGTAGGTATTGACACCAAAGCCCTCCATGTGCCTGTAGTTGAGTGGGATGCCAACATCATCGAAGAGGAAGGTGAACATGTGTAGGCTCTCTG
GGTGGTGAGAGAAGAAATCTACTATTCTCCAGTTCTCCTGCAAATTGGTCTTTGGGTTTGGCTTGAAAGCATGGACCATGTCAGGGAATTTCATCCCATC
TCGTATGAAAAACACAGGCATGTTGTTACCCACAAGGTCAAAG