Detailed information on CNT30475166


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 6e-153

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30475166

Peptides detected in this lncRNA

>peptide 1 (30 aa)
MVFPVRVLTKICMPPLSLSTRWRVDSFWML*

>peptide 2 (40 aa)
MVSDDSTSSVMVFPVRVFTKICIPPRRRSTKWRVDSFWIL*

Sequence

>CNT30475166
ATACGCCAAAACACATATATCTGGCCAAGATGGCCTCCAATAGTTGTACGAATCCAACACTTGCACAGTTAACACAAAGGTAAATTTGATAGCAGGCTAT
CAGAGAGAAACAGCTAAGGCAAACCAAGTTAACTTGCTGTTGCACATCAGCACAAGTTTGCAGGACTCGACATCACAGTAGAAACACACGGCATGGAAAC
ACACACGGCAACCAAACAGTGCACACCACTGAGAGAACCACCCAGACGAACAACTTCGATTAATTACTGACCACCACCACCACGGAGGCGCAGCACCAGG
TGGAGCGTGGACTCCTTCTGGATATTGTAGTCAGCGAGCGTGCGTCCATCCTCCAGCTGCTTACCAGCAAAGATCAGGCGCTGCTGGTCTGGTGGGATTC
CCTCCTTATCCTGGATCTTCGCCTTCACATTATCAATGGTGTCAGACGACTCGACCTCCAGCGTGATGGTCTTCCCAGTCAGAGTTTTCACAAAGATTTG
CATACCACCACGAAGGCGGAGCACCAAGTGGAGGGTGGACTCTTTCTGGATATTGTAGTCGGCAAGAGTGCGGCCATCCTCAAGTTGCTTTCCAGCAAAG
ATGAGGCGCTGCTGGTCTGGTGGAATGCCCTCCTTGTCTTGAATTTTCGCCTTCACGTTGTCGATCGTGTCCGAGGACTCAACCTCTAGCGTGATGGTCT
TTCCAGTCAAGGTCTTGACAAAGATCTGCATGCCTCCCCTGAGGCGAAGGACGAGGTGGAGGGTGGACTCCTTCTGAATGTTGTAGTCAGCTAAGGTACG
GCCATCCTCAAGCTGCTTGCCAGCGAAGATTAGCCGCTGCTGGTCTGGAGGGATTCCCTCTTTGTCCTGAATCTTTGCCTTGACATTGTCGATCGTATCA
GAGGACTCAACCTCAAGAGTGATGGTCTTCCCCGTGAGGGTCTTGACAAAGATCTGCATGCCACCCCTAAGCCTGAGCACGAGGTGGAGGGTAGACTCCT
TCTGGATGTTATAATCAGCGAGCGTCCGCCCATCCTCAAGCTGCTTGCCAGCAAAGATCAGACGCTGCTGATCCGGTGGGATTCCCTCCTTGTCTTGGAT
CTTTGCCTTGACGTTGTCAATTGTATCTGAGGACTCAACCTCGAGGGTGATGGTCTTGCCAGTAAGGGTCTTCACAAAGATCTGCATCTGCA