Detailed information on CNT30475159


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 6e-147

BLAST vs NONCODE:
NONMEST001181, E-value = 4e-104

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30475159

Peptides detected in this lncRNA

>peptide 1 (50 aa)
MPSLSWIFAFTLSIVSDDSTSRVIVLPVSVFTKICIPPRRRSTKWRVDSF*

>peptide 2 (54 aa)
GNHSEISRPAKTQNDRNKFCMPRQKPCSLIHYGNQAATKKGSICFAEKLGHKRL*

>peptide 3 (61 aa)
AITVRSADQLKRKMTETNSVCQDKNHVHLSITVIKLLQRKAAYVLRRNLDTRDSDLTSATI*

>peptide 4 (30 aa)
MVFPVRVFTKICMPPLSLSTRWRVDSFWML*

>peptide 5 (66 aa)
MFCGETWTQETLTSHRRQSELSNLDTRDSISHQTRQTELSNPTIPDLYWPPRRRRTRWSVDSFWML*

Sequence

>CNT30475159
TGGCAATCACAGTGAGATCAGCAGACCAGCTAAAACGCAAAATGACAGAAACAAATTCTGTATGCCAAGACAAAAACCATGTTCACTTATCCATTACGGT
AATCAAGCTGCTACAAAGAAAGGCAGCATATGTTTTGCGGAGAAACTTGGACACAAGAGACTCTGACCTCACATCGGCGACAATCTGAACTCAGTAACTT
GGACACAAGAGACTCGATCTCACATCAGACACGACAAACTGAACTCAGTAACCCAACCATCCCAGACCTTTACTGGCCACCACGGAGGCGCAGAACCAGG
TGGAGTGTGGACTCCTTCTGGATGTTGTAATCCCCCAGGGTGCGGCCGTCCTCAAGCTGCTTACCAGCAAAGATCAGGCGCTGCTGGTCCGGCGGGATGC
CCTCCTTATCCTGGATCTTTGCCTTCACATTGTCGATCGTGTCAGACGACTCAACCTCTAGGGTGATTGTCTTGCCAGTCAGCGTCTTCACAAAGATCTG
CATACCACCACGGAGGCGGAGCACCAAGTGGAGGGTCGACTCCTTCTGAATGTTGTAGTCAGCAAGAGTGCGGCCATCCTCGAGCTGCTTCCCGGCAAAG
ATGAGGCGCTGCTGGTCTGGTGGAATGCCCTCCTTGTCTTGAATCTTGGCCTTCACATTGTCAATTGTGTCTGAGGACTCGACCTCCAGTGTGATGGTCT
TTCCAGTCAGGGTCTTCACAAAGATCTGCATGCCACCCCTGAGCCTGAGCACAAGGTGGAGAGTAGACTCCTTCTGGATGTTATAGTCAGCCAGCGTCCG
CCCATCCTCGAGCTGCTTGCCAGCAAAGATCAGGCGCTGCTGATCCGGCGGGATTCCCTCCTTGTCCTGGATCTTTGCCTTGACATTGTCAATTGTATCT
GAGGACTCAACCTCG