Detailed information on CNT30475137


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30216754Saccharum spontaneumKalanchoe fedtschenkoi13.8820.9182.6192forward
CNT30596912Saccharum spontaneumOryza meridionalis15.3824.3482.35102forward
CNT30369646Saccharum spontaneumOryza glumipatula38.9148.581.4258forward
CNT30148536Saccharum spontaneumBrachypodium distachyon13.2741.1289.7788forward
CNT30115905Saccharum spontaneumOryza nivara38.9148.2281.78258forward

Expression of CNT30475137

Peptides detected in this lncRNA

>peptide 1 (29 aa)
NSKFVDCMMFIITICLRCQDFSTWTSQQE*

>peptide 2 (42 aa)
MPAAIPFMVRMSVSSRPGGYSLAGEGKRPSRCSACRRRYPSW*

>peptide 3 (59 aa)
MPAAIPFMVRMSVSSRPGGYSLAGFSFTSPAGLFSSANSLDSGGCGVTLKLGSLIRFSV*

Sequence

>CNT30475137
AAATAGTAAATTTGTAGATTGTATGATGTTCATTATTACAATATGTTTAAGATGCCAAGATTTTTCCACTTGGACTTCACAACAAGAGTGAAAATATAAA
GAGGCCAAAGCCGAGGAAATTACATAAACATAAACATAAACATAAACATAGTGAAAACAGAAGGTGTCAGTTTTCAGCATTTCCATCCAAAACTGACAAA
ACGCCACCATCCGGAAGCTGATTATTATTGCCGTGCAGTACTCTGCAGGTGAGTGAAGGGAAGCGGCCTAGCCGGTGTTCTGCATGCCGGCGGCGATACC
CTTCATGGTGAGGATGAGCGTGTCTTCCAGGCCGGGCGGGTACTCGCTCGCCGGTGAAGGGAAGCGGCCTAGCCGGTGTTCTGCATGCCGGCGGCGATAC
CCTTCATGGTGAGGATGAGCGTGTCTTCCAGGCCGGGCGGGTACTCGCTCGCCGGGTTCAGCTTCACCAGTCCGGCGGGCTTGTTCTCGTCGGCGAACTC
CTTGGACAGTGGCGGCTGCGGCGTCACCTTGAAGCTGGGGTCCCTTATCCGCTTCAGCGTGTAGGCCTGCAACACGTTCAGGGTGGTGATGTAGGGATTG
CGTAGCCGCAGCCCCTGCTTCAGGTAAGGATCGCCTTCAAGAATATCCTTGTGCCCAGCGATC