Detailed information on CNT30474874


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30474874

Peptides detected in this lncRNA

>peptide 1 (85 aa)
QNPPAVVAAAMSHTTMATTGGISDATLDANMAVSSVVRVHTAAFSLRLVPPALARSNLTRQRKSSRSAASASSTKEMEVASPQEL*

>peptide 2 (37 aa)
MASPELHARTPKPSLLRPEKCSSMRLGRGRKENQGCS*

>peptide 3 (31 aa)
MFVHAIRQGQEREPRLFVVWQLKLNAYYRQD*

Sequence

>CNT30474874
CCCAGAACCCGCCGGCGGTCGTGGCCGCGGCCATGAGCCACACCACAATGGCTACGACCGGTGGCATCAGTGACGCCACCCTGGACGCGAACATGGCCGT
GAGCAGCGTCGTGAGAGTCCACACGGCGGCCTTCAGCCTGCGCCTTGTTCCTCCTGCCCTGGCTCGCTCCAACCTGACGAGGCAGAGGAAGAGCAGCAGG
AGCGCGGCGTCCGCGAGCAGCACGAAGGAGATGGAGGTCGCGTCACCCCAGGAGTTGTAGATGGCGAGCCCCGAGTTGCACGCCAGGACGCCGAAGCCCA
GCTTGCTTAGGCCGGAGAAATGTTCGTCCATGCGATTAGGCAGGGGCAGGAAAGAGAACCAAGGTTGTTCGTAGTATGGCAGCTCAAACTAAACGCGTAC
TATAGACAGGATTAGCATTGGGAGAACGTTTGGTGTTATCACTCGTCAACGAAACAAACACGAATATAATTGGCTGTCACCTACTCTACTCACCTCACCC
AGTATAGGTGATCCGCTCCACCAACGGCTAGTTGTACTATTTGTTCATTTATTATTAATTGC