Detailed information on CNT30474193


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673686Saccharum spontaneumSetaria viridis31.7530.3485.45220forward
CNT30521631Saccharum spontaneumSetaria italica31.7519.8285.45220forward
CNT30583022Saccharum spontaneumEchinochloa crusgalli30.8827.6580.37214forward
CNT30497306Saccharum spontaneumDigitaria exilis22.9420.3681.76159forward

Expression of CNT30474193

Peptides detected in this lncRNA

>peptide 1 (96 aa)
MEAVAALCQLHQSFHFQHEEQIPHLLVLEKKLHFPFSHFHYNPKGHCLEPPSPPGWAAHYTISWPPHQRKVPIAVQCKIHHHETEHLCILHQMHETQ

>peptide 2 (78 aa)
MRSRFLIYWSLRRSFIFRFHIFIITQRVTAWSLLHLLAGQLTTQYHGLLTRGRFQLQFSARFTTMRLSIFAYFTRCTRL

>peptide 3 (60 aa)
PHQMKVVATAAPCQLHQVLHFHYHEQLQCLALSVQQQPLPSAHLHHFLKGQCLEPPFRLG*

>peptide 4 (31 aa)
MSSSLDMSTMASPDGGSCCSVSASSIFSFSA*

Sequence

>CNT30474193
CCTCACCAGATGAAGGTGGTGGCAACTGCAGCTCCGTGCCAGCTTCACCAAGTTTTGCATTTTCACTACCATGAGCAACTTCAGTGCTTAGCTCTCTCTG
TGCAGCAGCAGCCTCTCCCATCTGCGCATCTTCATCATTTCCTGAAGGGCCAGTGCTTGGAGCCACCTTTTCGTCTTGGCTGAGTAGCTCGCTAGATACA
TCTGCCATGGCCTCACCAGACGGAGCTTCACCAAGTTCCGCATTTTCACTACCATGAGCAACTTCAGTGCTTAGCTCTCTCTGTGCAGCAGGAGCCTCTT
CCATCTGTGCATCTTCATCATTTCCTAAAGTGCCAGTGCTTGGAGCCACCTTTTCGTCTTGGATGAGTAGCTCGCTAGATATGTCTACCATGGCCTCACC
AGATGGAGGCAGTTGCTGCTCTGTGTCAGCTTCATCAATCTTTTCATTTTCAGCATGAGGAGCAGATTCCTCATTTACTGGTCCTTGAGAAGAAGCTTCA
TTTTCCGTTTTCACATTTTCATTATAACCCAAAGGGTCACTGCTTGGAGCCTCCTTCACCTCCTGGCTGGGCAGCTCACTACACAATATCATGGCCTCCT
CACCAGAGGAAGGTTCCAATTGCAGTTCAGTGCAAGATTCACCACCATGAGACTGAGCATCTTTGCATACTTCACCAGATGCACGAGACTCAG