Detailed information on CNT30474057


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369278Saccharum spontaneumOryza glumipatula13.4128.588.1459forward
CNT30579340Saccharum spontaneumEchinochloa crusgalli30.683683.7135forward

Expression of CNT30474057

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MACASSSILAPVTSLTTFPPFRILNVGTTFIPSSFASGCNKQVPHKYSGQQQVFLFSVFIHAIHISST*

>peptide 2 (40 aa)
DAVWWLIHSESTLVTHHVRYFMHSRTAPILLNVQAIFVVF*

>peptide 3 (31 aa)
GCRVVAHSFRVYTSYTSRTLLHAFAHSTDLA*

Sequence

>CNT30474057
GGGATGCCGTGTGGTGGCTCATTCATTCAGAGTCTACACTAGTTACACATCACGTACGCTACTTCATGCATTCGCGCACAGCACCGATCTTGCTTAACGT
TCAGGCCATTTTCGTTGTCTTCTGATCAGCCTGACTTGACTGTGTCGATGGCATGCGCTAGCTCCTCGATCTTGGCGCCGGTGACCTCCTTGACGACCTT
CCCACCCTTTAGGATCTTGAACGTTGGCACGACCTTTATTCCCAGCTCCTTTGCAAGCGGCTGCAACAAGCAAGTGCCACACAAATACAGCGGCCAGCAG
CAGGTTTTTTTGTTTTCAGTATTCATCCATGCCATACATATTAGTTCCACATAGCTAGCAGTGATGACTGATGAGTGAAATACAGACACAGAACAGAAGA
GATCGATCATAGATGTCAATCAAAGCTAAGTAATCCTAGC