Detailed information on CNT30473163


BLAST search results

BLAST vs Swiss-Prot:
sp|P27497|CB29_MAIZE, E-value = 6e-165

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522457Saccharum spontaneumSetaria italica48.7770.1386.39573forward
CNT3011335Saccharum spontaneumZea mays67.2377.3892.41790forward
CNT30129910Saccharum spontaneumCorymbia citriodora45.9685.7187.96540forward
CNT30150713Saccharum spontaneumBrachypodium distachyon30.3861.1391.32357forward

Expression of CNT30473163

Peptides detected in this lncRNA

>peptide 1 (33 aa)
MPCRSPVTTKSHPEKLSKIQRPSSDQTPDFSGK*

>peptide 2 (34 aa)
NGWTALIEKNSTTDQQCSIKLNTRYFYSSHCKDR*

>peptide 3 (43 aa)
MAWTKNPNMENMARRPFLSSFTLSSAKASGSSARPSGSKLPPG*

>peptide 4 (29 aa)
MAQREWITSSSRFLANVSGSADSPAVSQP*

Sequence

>CNT30473163
AATGGCTGGACTGCACTGATCGAAAAAAATTCAACAACGGATCAACAATGCAGTATAAAGCTAAACACAAGATATTTTTACTCTAGTCACTGTAAGGATC
GCTAGAAGAATGCCTTGCAGAAGCCCTGTGACCACAAAATCACACCCAGAAAAGTTGAGCAAAATTCAGCGGCCCTCTTCTGATCAAACACCCGATTTTT
CAGGCAAATAAAATCGACAGTGATGAATGAAAAAGGAAAAAAAATGAGTCGTATTGGACGCGGCGCGAGATAATGATTAATGAACACAATTATTCCTTCT
TGATTGAACCCTGGTAATTTACATCATGGTACAAACTGAAACCAGTGCGCGCTCAGGTGCATCCGGACACCTCCTTCACTTGCCGGGCACGAAGTTGGTG
GCGTAGGCCCAGGCGTTGTTGTTGACGGGGTCGGCGAGGTGGTCGGCAAGGTTCTCGAGCGGGCCCTTGCCGGTGACGATGGCCTGGACGAAGAATCCGA
ACATGGAGAACATGGCGAGGCGGCCGTTCTTGAGCTCCTTCACCTTGAGCTCGGCGAAGGCCTCGGGGTCGTCGGCGAGGCCGAGCGGGTCGAAGCTGCC
GCCGGGGTAGAGCGGGTCGACGACCTCGCCGAGCGGGCCGCCGGCGATGCGCACGACCTGGACGGCCCAGATGGCGAGGATGCTCTGCGCGTGGATCAGG
CTCGGGTTGCCCAGGTAGTCCAGCCCGCCCTCGCTGAAGATCTGTGACCCGGCCTTGAACCACACGGCCTCGCCGAACTTGACGCCGTTGCGGGCGAGCA
GCTCGGGGAACACGCAGCCGAGCGCGCCCAGCATGGCCCAGCGGGAGTGGATCACCTCCAGCTCCCGGTTCTTGGCGAACGTCTCGGGGTCCGCGGACAG
CCCGGCCGTGTCCCAGCCGTAGTCGCCGGGGAACTCGCCCGTCAGGTAGCTCGGGGGCTCGCCGGAGAGCGGGCCCAGGTAGAGCACGCGGTCGGGGCCG
TACCACGGGCTGCCGGACGCCGCCGCCGGCTTGGCCTTCGCCGCCGTCTTGCGCATCGTCACGCGGGCCTCGCCGAACAGGGACGACGGCACGTTCACGG
CCTTGCCGGCGAAGGCCGTGGAGGAGAGGGCCATGGTGCTGCTCGCCATTGCGCTGCTTCTGCTTTGCACTGGTT