Detailed information on CNT30472624


BLAST search results

BLAST vs Swiss-Prot:
sp|P27497|CB29_MAIZE, E-value = 1e-123

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30393441Saccharum spontaneumTriticum turgidum61.0162.8888.03493forward
CNT30587514Saccharum spontaneumMusa acuminata66.8364.985.93540forward
CNT30129909Saccharum spontaneumCorymbia citriodora66.4673.8790.32537forward
CNT30345519Saccharum spontaneumEragrostis tef43.4460.5295.73351forward

Expression of CNT30472624

Peptides detected in this lncRNA

>peptide 1 (46 aa)
MAWTKNPNMENMARRPFLSSFTLSSAKASGSSARMLCAWIRLGLPR*

>peptide 2 (29 aa)
MAQREWITSSSRFLANVSGSADSPAVSQP*

>peptide 3 (33 aa)
MPCRSPVTTKSHPEKLSKIQRPSSDQTPDFSGK*

Sequence

>CNT30472624
GAATGCCTTGCAGAAGCCCTGTGACCACAAAATCACACCCAGAAAAGTTGAGCAAAATTCAGCGGCCCTCTTCTGATCAAACACCCGATTTTTCAGGCAA
ATAAAATCGACAGTGATGAATGAAAAAGGAAAAAAAATGAGTCGTATTGGACGCGGCGCGAGATAATGATTAATGAACACAATTATTCCTTCTTGATTGA
ACCCTGGTAATTTACATCATGGTACAAACTGAAACCAGTGCGCGCTCAGGTGCATCCGGACACCTCCTTCACTTGCCGGGCACGAAGTTGGTGGCGTAGG
CCCAGGCGTTGTTGTTGACGGGGTCGGCGAGGTGGTCGGCAAGGTTCTCGAGCGGGCCCTTGCCGGTGACGATGGCCTGGACGAAGAATCCGAACATGGA
GAACATGGCGAGGCGGCCGTTCTTGAGCTCCTTCACCTTGAGCTCGGCGAAGGCCTCGGGGTCGTCGGCGAGGATGCTCTGCGCGTGGATCAGGCTCGGG
TTGCCCAGGTAGTCCAGCCCGCCCTCGCTGAAGATCTGTGACCCGGCCTTGAACCACACGGCCTCGCCGAACTTGACGCCGTTGCGGGCGAGCAGCTCGG
GGAACACGCAGCCGAGCGCGCCCAGCATGGCCCAGCGGGAGTGGATCACCTCCAGCTCCCGGTTCTTGGCGAACGTCTCGGGGTCCGCGGACAGCCCGGC
CGTGTCCCAGCCGTAGTCGCCGGGGAACTCGCCCGTCAGGTAGCTCGGGGGCTCGCCGGAGAGCGGGCCCAGGTAGAGCACGCGGTCGGGGCCGTACCAC
GGGCTGCC