Detailed information on CNT30470687


BLAST search results

BLAST vs Swiss-Prot:
sp|P27497|CB29_MAIZE, E-value = 4e-149

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30690606Saccharum spontaneumOryza sativa81.1874.5493.35647forward
CNT30395272Saccharum spontaneumTriticum turgidum58.3449.2193.55465forward
CNT30554829Saccharum spontaneumOryza glaberrima73.7849.2192.52588forward
CNT30241578Saccharum spontaneumAvena sativa83.9463.4188.19669forward
CNT30656613Saccharum spontaneumTriticum dicoccoides82.1874.5290.38655forward
CNT30684601Saccharum spontaneumTriticum urartu68.8857.1391.62549forward
CNT30345518Saccharum spontaneumEragrostis tef70.3968.7593.05561forward
CNT30596867Saccharum spontaneumOryza meridionalis80.9360.0692.71645forward
CNT30369301Saccharum spontaneumOryza glumipatula64.6256.8493.98515forward
CNT30103295Saccharum spontaneumOryza rufipogon65.1242.6893.83519forward
CNT30574765Saccharum spontaneumOryza barthii81.1872.9492.89647forward
CNT30582834Saccharum spontaneumEchinochloa crusgalli90.9775.6894.62725forward
CNT30117513Saccharum spontaneumOryza nivara81.1853.2992.58647forward
CNT30556694Saccharum spontaneumPanicum hallii74.2861.9293.07592forward

Expression of CNT30470687

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MAQREWITSSSRFLANVSGSADSPAVSQP*

>peptide 2 (31 aa)
MRYPSTAPMSTTWTAQMARMLCAWIRLGLPR*

Sequence

>CNT30470687
TTGAACCCTGGTAATTTACATCATGGTACAAACTGAAACCAGTGCGCGCTCAGGTGCATCCGGACACCTCCTTCACTTGCCGGGCACGAAGTTGGTGGCG
TAGGCCCAGGCGTTGTTGTTGACGGGGTCGGCGAGGCGGCCGTTCTTGAGCTCCTTCACCTTGAGCTCGGCGAAGGCCTCGGGGTCGTCGGCGAGGCCGA
GCGGGTCGAAGCTGCCGCCGGGGTAGAGCGGGTCGACGACCTCGCCGAGCGGGCCGCCGGCGATGCGGTACCCCTCGACGGCGCCCATGAGCACGACCTG
GACGGCCCAGATGGCGAGGATGCTCTGCGCGTGGATCAGGCTCGGGTTGCCCAGGTAGTCCAGCCCGCCCTCGCTGAAGATCTGTGACCCGGCCTTGAAC
CACACGGCCTCGCCGAACTTGACGCCGTTGCGGGCGAGCAGCTCGGGGAACACGCAGCCGAGCGCGCCCAGCATGGCCCAGCGGGAGTGGATCACCTCCA
GCTCCCGGTTCTTGGCGAACGTCTCGGGGTCCGCGGACAGCCCGGCTGTGTCCCAGCCGTAGTCGCCGGGGAACTCGCCCGTCAGGTAGCTCGGGGGCTC
GCCGGAGAGCGGGCCCAGGTAGAGCACGCGGTCGGGGCCGTACCACGGGCTGCCGGACGCCGCCGCCGGCTTGGCCTTCGCCGCCGTCTTGCGCATCGTC
ACGCGGGCCTCGCCGAACAGGGACGACGGCACGTTCACGGCCTTGCCGGCGAAGGCCGTGGAGGAGAGGGCCATGGTGCTGCTCGCCATTGCGCTGC