Detailed information on CNT30470322


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30470322

Peptides detected in this lncRNA

>peptide 1 (45 aa)
LRPELVVVHLAAAVPVKPREQAAVQACELVGYGCFIHAEVLLQHA*

>peptide 2 (47 aa)
PPGTRGGPPCRCRPCQTARTGCGTGLRARRVRLLHPRRSASPARVDS*

>peptide 3 (55 aa)
SARNSWWSTLPLPSLSNRANRLRYRPASSSGTVASSTPKCFSSTRRLMSSSAISV*

Sequence

>CNT30470322
CTCCGCCCGGAACTCGTGGTGGTCCACCTTGCCGCTGCCGTCCCTGTCAAACCGCGCGAACAGGCTGCGGTACAGGCCTGCGAGCTCGTCGGGTACGGTT
GCTTCATCCACGCCGAAGTGCTTCTCCAGCACGCGTAGACTCATGAGCTCCTCGGCCATCTCGGTGTAGGTGAGCAGGCCGTCGTGGTCGGCGTCTAGCG
CGGCGAACCGGCCGTCCACCGAGGAGTTGAAGGCGCCCTCGTCCTCCACGAAGCTCCGCACCGTGCTCCCGTCTAAGATCTCCACGCTCATTTTCGGATT
CTCTCGGTGTTCTTGGGATGTGTTGGTGTGAGAGTTTTGCTCTGCTCTGCTCTGGG