Detailed information on CNT30467325


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30467325

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MLADGRRLMTIMCCAAVCLCLIYIHTHRELLVFEFIPVVVPVFCVLCIVYLSSHSFMMLANICCSCTIR

>peptide 2 (41 aa)
MLRRHLLLLRPRHVLLRSTYARTSSTGTAASCSCVLHRPVL*

>peptide 3 (79 aa)
MSYQAGYPPPGQQQAYGAQPPPAYVAPPPAYPPNQQDGGAYYGQPQPQQQQTTTSRGGDGFWKGCCAAICCCCVLDMCF*

>peptide 4 (38 aa)
VTMDTAWAPAGLFVFYSIYRKHEWITIIVHPSTPTVCS*

Sequence

>CNT30467325
CGGTGACGATGGATACCGCGTGGGCGCCTGCTGGCCTGTTCGTGTTCTATTCTATATATAGGAAGCATGAATGGATTACGATCATCGTCCATCCATCCAC
ACCCACAGTTTGCAGCTGACCATAAAGGACAACAGCGCTAGCTAGCTTGTTGCAGTTTTAATTTGCAGCTGATCATCGATCGATCATGAGCTACCAAGCA
GGCTACCCACCGCCGGGCCAGCAGCAGGCCTACGGCGCCCAACCGCCGCCGGCGTACGTCGCGCCACCACCGGCGTACCCACCGAATCAGCAGGACGGCG
GCGCGTACTACGGCCAGCCGCAGCCGCAGCAGCAGCAGACCACGACCAGCCGCGGCGGTGACGGTTTCTGGAAAGGATGCTGCGCCGCCATCTGCTGCTG
CTGCGTCCTCGACATGTGCTTCTGAGGTCGACGTACGCGAGGACATCATCGACCGGGACAGCTGCTAGCTGCTCGTGCGTGCTCCATCGCCCTGTCCTGT
AGGGCATGCTAGCTGATGGCCGGCGGTTGATGACCATCATGTGCTGCGCTGCTGTGTGCCTGTGTCTCATTTATATACATACTCATAGAGAGTTGCTCGT
CTTCGAATTCATTCCTGTTGTTGTACCTGTGTTCTGTGTATTATGCATTGTATATTTGTCGAGCCATTCTTTTATGATGCTGGCTAATATATGCTGCTCT
TGCACCATCCGCC