Detailed information on CNT30467184


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30467184

Peptides detected in this lncRNA

>peptide 1 (45 aa)
THKTCFFYLLMIHKLSKAYTWIMDASRWKRTGKGGYTHRPYIVLQ*

>peptide 2 (49 aa)
MMPVPMGGERDGGSGFDGSGSGLGFGSGVGLGIGWGSGLDGSGWGFGLG*

>peptide 3 (29 aa)
MARARWKHSERRPDLMVATSPDGRLISLQS

>peptide 4 (51 aa)
MDHGCIPMETHGKRWVHTSSIHSTTVVHTIYTTRELTLTQIVLLISHRQKL*

Sequence

>CNT30467184
AGACACACAAGACTTGTTTCTTTTATTTATTGATGATACACAAACTTAGCAAAGCATATACATGGATCATGGATGCATCCCGATGGAAACGCACGGGAAA
AGGTGGGTACACACATCGTCCATACATAGTACTACAGTAGTACACACTATATATACGACGAGAGAGCTCACTCTTACACAAATAGTATTACTTATTAGTC
ATAGACAAAAGCTATAGGTGGTATGCACGTTGGTAGGTGCGACTATGCTGCTCTTAGTTCCCTTCCATGATGCCCGTGCCAATGGGTGGTGAAAGAGATG
GTGGCTCTGGCTTCGATGGTTCTGGTTCTGGTTTGGGTTTTGGATCTGGTGTAGGTTTGGGCATTGGCTGGGGCTCTGGCTTGGACGGTTCAGGTTGGGG
TTTTGGGCTCGGTTGAGGCTCCGGTTGAGGTTTAGTTCCTGGAGTAGGTTTGGGGCTTGGCTCAGGCTCGGGCTTTGGTTCAGGTTGCGGGATAGGTGGT
TGTGGTGTTGGTTTTGGATCTGGCTGCGGTGTGGGTTTGGGATCTGGTTTTGGTTCTGGTTGTGGTGTCGGTTTAGGTTCCAGCTTTGGGTCTGGTTGTG
GTGCAGGTTTCGGTTCCGGTTGCGGTGCCGGTTTAGGTTCTGGCTTTGGATCTGGTTGTGGTGCGGGTTTTGGTTCAGGCTGTGGTGACGACTTGGGTTC
CGGCTTTGGGTCTGGTTGTGGTGCAGGTTTTGGGTCAGGCTGCGGTGTCGGCTTGGGTTCTGGCTTTGGGTCTGGTTGTGGTGCGGGCTTTGGTTCAGGT
TGCGGCGTTGGTTTGGGTTGCGGCTTTAGGTCGATTATCCTACTATGAGCGAGGCCAGGAACATTTGCAGCTAGTGTAATGGCTAGAGCTAGGTGGAAAC
ACAGTGAGAGGAGGCCGGACCTCATGGTCGCCACCAGTCCAGATGGCCGCTTGATCTCACTCCAATCT