Detailed information on CNT30467085


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6Z2W3|ARFE_ORYSJ, E-value = 2e-130

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30305094Saccharum spontaneumTriticum aestivum9.7348.9481.16207forward
CNT3068016Saccharum spontaneumLeersia perrieri5.531.2893.16117forward

Expression of CNT30467085

Peptides detected in this lncRNA

>peptide 1 (38 aa)
SREFLFKNGISLIDESMELNAISATPNECEIIEDDNSC*

>peptide 2 (40 aa)
MQPEYCAIGSFSTLQDPYHLYQLLFPCTFLLQILQFQTSF*

>peptide 3 (49 aa)
MYFSVSKVVPSKASSLRGSIWPSMFAPNRKLFLASVTSNSLSGTVSLNG*

>peptide 4 (85 aa)
MLRLSLENDLRLLEFANCSVCWFWGGSSEVLNWMLFCCRNWGWKLICLDRSAAARVCTGFPANEFSNSGCMTVLAREEFCCMFIH*

>peptide 5 (31 aa)
MVRLKRLSISELSSSVIPGCLGRFAVNNGEG*

>peptide 6 (29 aa)
MVILKKREHYPSSLTALRQAHANSEHPWR*

>peptide 7 (29 aa)
MKNGAITGSTSQRETLVRLSLGAASSHAT*

>peptide 8 (39 aa)
MKVENFVAVIRQPEKGKLKSLMRTYPNNPSECCSCSLVQ*

Sequence

>CNT30467085
GGAGCCGGGAATTTCTATTTAAGAATGGGATATCATTGATTGATGAATCTATGGAATTGAATGCAATATCAGCAACACCAAATGAATGTGAAATCATTGA
AGATGATAACTCTTGTTGAGAATCCTTTGATGAAATGTAGTTAGATATGCCATTTCCTGGCATCTGATCCATGTACTTCTCAGTTTCAAAGGTAGTTCCA
AGCAAGGCGTCTTCATTAAGAGGCTCCATATGGCCATCAATGTTTGCCCCAAATAGAAAGTTATTTCTGGCATCTGTAACCTCAAACTCGCTATCTGGAA
CCGTTTCTCTCAACGGTTGATGCTGATTGAAGGATGAAGGTGGAAAATTTTGTTGCAGTGATCCGTCAGCCTGAGAAAGGCAAACTGAAGTCGCTGATGA
GGACGTATCCAAATAATCCATCTGAGTGCTGTTCATGTAGTCTTGTCCAGTAGCTGGCCTTTCTTCAGCCATCTTGGGAATCACCATTGTGTGCTGTGTA
CTCTCAAAAGGTTTCATACCCTGTTCAAGTGTAGAACCTAATACAACAGATGATTGAGGAGCCTTTGCTGCAGTAGGTAAACATTGGTTCTTGGAGCTAC
TTGGAGTTGATGGCAAAATAACAGGATTATTGTTTGTGGATGGTGATTTTGAAGAAGAGGGAACATTATCCGTCTTCATTGACTGCACTCCGCCAGGCAC
ATGCAAATAGCGAGCACCCATGGAGGTGACAATTTCTGATTTTACAATAGAAACAGCATTCCCAGGAAACTCTTGAATTGGTTTGTGAGGTTGAGTCTTT
TGCTGCGTCGGGTACTGAATAGTGCTACTGCTATGCAAACCTACCACTTGGGTAGCTACCTGCGAGCACTGCTGAGCAGTTGACTGAGAATTTACTGCTT
GTTGCTGCAAATCCAATATCATTTTCTGCTGTTCCATGGCCAGAGTCTGCTGTGGTTGTAGAGCCTTCAATAATTGTATTTTCATCTGATCAGATAACTG
TGTTACCATGTTTGCGTCATTAGGTACCTGAAAAGGCTGTATCTTTATTTGCTGTTGTTCCTGCACTGACTGCTGAACCTGCTGCTCCTTGTATGGTGGT
GTGATTTTGAACCAGAGGTTGCTGTTGCTGTAGTTGAGCTTGGACAATGACTTGAGGATGCTGAGGCTGAGCCTGGAGAATGACTTGAGGTTGCTGGAGT
TTGCTAACTGTTCGGTCTGCTGGTTTTGGGGAGGTAGCAGCGAAGTGTTGAACTGGATGTTATTTTGTTGCAGGAACTGGGGCTGGAAGCTAATTTGCCT
AGATAGATCAGCTGCAGCCAGAGTTTGTACAGGTTTTCCAGCTAACGAATTTAGCAATTCTGGTTGCATGACTGTGTTGGCAAGAGAGGAGTTCTGTTGC
ATGTTCATCCACTGAACTAAACTTAATCCAGGAACTAAACTGTTTTGAGTACTCAGATCTTTCTTGCCAATCTCCTCACCAAACCATGGCATGGTCCGCT
TAAAAAGATTGTCCATTTCTGAGCTATCATCATCTGTTATCCCAGGTTGTCTCGGACGTTTTGCAGTGAACAATGGCGAGGGATAAATGAAGAATGGAGC
TATAACAGGTTCAACTTCCCAAAGGGAAACCCTGGTGCGTCTCTCACTTGGCGCTGCTTCATCCCATGCAACCTGAATATTGCGCCATTGGGAGTTTTTC
CACCTTACAGGATCCATATCACTTATACCAGTTATTGTTCCCATGTACCTTCTTGTTGCAGATTCTTCAGTTTCAAACATCATTCTAAACCGCATGCCAA
GTGATAGTTGGTTGCTATAGACAGCCTTCTGGTACTTGGCAAAAGGAATAACAAATTCTGAAGGACTAGCCCTTGGATTATAGAATACTGTGAATTGGCT
GTTATTAGCTGCTGCATGGGCTGCAGCAGCAATAATTCCAATATGCATACTGTCACTAGACAAAACAGATGATGAGAGGTTAACAGGCTGCCTATTTGCC
CGCCTTATCCCCAAGAGGAGTTGCTGTCTTCCGTCCCTAATAAACAGGACTGAGTCGCCAGCAAGGAGCCTCTTTCCACTGACAAATAGGCTCCAGCCAG
TAGTCAGCAAATGCCTTTTAGGCTGGCC