Detailed information on CNT30465769


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9XF89|CB5_ARATH, E-value = 7e-56

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697405Saccharum spontaneumOryza sativa36.5246.2689.52210forward
CNT30677042Saccharum spontaneumSetaria viridis54.0967.0393.89311forward
CNT30524410Saccharum spontaneumSetaria italica49.3936.3294.72284forward
CNT30184672Saccharum spontaneumSecale cereale25.0443.6488.19144forward
CNT30295002Saccharum spontaneumTriticum aestivum42.4347.2989.34244forward
CNT30390869Saccharum spontaneumTriticum turgidum28.3534.6889.57163forward
CNT30555388Saccharum spontaneumOryza glaberrima23.4826.7994.07135forward
CNT30438779Saccharum spontaneumAegilops tauschii34.2631.2286.8197forward
CNT30249379Saccharum spontaneumAvena sativa29.3942.5787.57169forward
CNT30662842Saccharum spontaneumTriticum dicoccoides35.1336.1487.13202forward
CNT30137065Saccharum spontaneumLolium perenne35.8345.0889.81206forward
CNT306938Saccharum spontaneumZea mays43.1331.2393.15248forward
CNT30353507Saccharum spontaneumEragrostis tef36.1716.2893.27208forward
CNT30365046Saccharum spontaneumSorghum bicolor70.6142.1696.55406forward
CNT30597113Saccharum spontaneumOryza meridionalis36.522882.86210forward
CNT30371307Saccharum spontaneumOryza glumipatula4423.3683253forward
CNT30151052Saccharum spontaneumBrachypodium distachyon18.4345.6989.62106forward
CNT30104243Saccharum spontaneumOryza rufipogon30.0932.0487.86173forward
CNT30578126Saccharum spontaneumOryza barthii4430.0590.91253forward
CNT30581942Saccharum spontaneumEchinochloa crusgalli23.6529.2591.91136forward
CNT30498372Saccharum spontaneumDigitaria exilis36.5244.2194.29210forward
CNT30117889Saccharum spontaneumOryza nivara30.9631.594.94178forward

Expression of CNT30465769

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MKRIIPPLDNLHAWAWHILQTLTYSFLPGKIKDGSSSA*

>peptide 2 (53 aa)
MKKANMENMASRPFLISFTLRMAAWSGSLAKPRGSKGPPGCSLSSRSSPLMIR*

Sequence

>CNT30465769
AAACTTAAGTAGGACATCTCAGGCACAAATTGAAGCAGCAGTTATATCAGAGATTCAGAGATCAGAATGAAAAGGATTATTCCCCCTCTTGATAATTTAC
ACGCATGGGCATGGCACATTCTTCAGACCCTCACATACAGCTTTCTTCCCGGTAAAATCAAAGACGGCAGCAGCAGCGCATGACTTGGCATTTGCTCTCG
GCGTGGCGTCCGTGCGTCCTCACAGGCTTGGCGTCCTCTCGGCGGCGCCGGAGATGACGGTGAGCAGGTTGTTGCCGAAGGGGTCGCTGAGGTGCTTGGC
GAGGTTTTCGACGGGGCCTTCGCCGGTGACGTAGGCCTGGATGAAGAAGGCCAACATGGAGAACATGGCGAGCCGGCCGTTCTTGATCTCCTTCACCTTG
AGGATGGCGGCCTGGTCGGGGTCGCTGGCCAAGCCCAGGGGGTCGAAGGGCCCACCGGGGTGCAGCTTGTCCTCAAGGTCCAGTCCGTTGATGATCCGGT
AGTACTCGGCGCCGCCGACGAGGACGACCTCCGCGACCACGGCCACCACCAGGTTGATGGGGATGCTGTTGCCGA