Detailed information on CNT30465578


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30465578

Peptides detected in this lncRNA

>peptide 1 (42 aa)
MCFPQVCSVSLCFSCLLTGVAALFAQGTCPPLPGPIFDSALLM

>peptide 2 (49 aa)
MGCTPGSSIRRRSSRQRQRRCSSHLPLRRWTCAKVWSVRAVCVFPRCVL*

>peptide 3 (73 aa)
MSTDPEVARFWIPIFRVWVYLGIAAIVLMTCVNIVYYMPVYGVYARKFNPPPQQPAAAAAVQLPPPPPEMDMC*

>peptide 4 (81 aa)
PEQLIPRVFDSRNPDLDLPTTGPQLRALRDLDPAAPSINSGESAGAPSFLLARCPQIPRWPASGYQSSASGFTSASPRSCS*

Sequence

>CNT30465578
CCCAGAGCAATTGATCCCCAGAGTTTTCGATTCCCGCAATCCTGATCTCGATCTGCCGACCACAGGTCCACAGCTCCGTGCGCTTCGCGATCTCGACCCG
GCGGCTCCGTCGATCAATTCCGGCGAGTCCGCAGGTGCTCCTTCCTTCCTCCTCGCCCGATGTCCACAGATCCCGAGGTGGCCCGCTTCTGGATACCAAT
CTTCCGCGTCTGGGTTTACCTCGGCATCGCCGCGATCGTGCTCATGACGTGCGTGAACATCGTCTACTACATGCCCGTGTATGGGGTGTACGCCCGGAAG
TTCAATCCGCCGCCGCAGCAGCCGGCAGCGGCAGCGGCGGTGCAGCTCCCACCTCCCCCTCCGGAGATGGACATGTGCTAAGGTTTGGTCCGTGCGTGCT
GTATGTGTTTTCCCCAGGTGTGTTCTGTAAGTCTCTGTTTTAGTTGCTTACTCACAGGTGTTGCTGCTCTCTTTGCTCAAGGTACATGCCCTCCCCTTCC
CGGCCCTATCTTTGATTCAGCACTTTTAATG