Detailed information on CNT30464658


BLAST search results

BLAST vs Swiss-Prot:
sp|P07398|RBS3_WHEAT, E-value = 5e-32

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672378Saccharum spontaneumSetaria viridis21.1624.4383.51194forward
CNT30520764Saccharum spontaneumSetaria italica21.1631.5483.51194forward
CNT306401Saccharum spontaneumZea mays21.9228.9692.54201forward
CNT30351770Saccharum spontaneumEragrostis tef20.519.2686.17188forward
CNT30365630Saccharum spontaneumSorghum bicolor26.6137.7795.49244forward
CNT30585439Saccharum spontaneumEchinochloa crusgalli20.6129.8682.54189forward

Expression of CNT30464658

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MASCSSLYTCDASVQPNMGSFHMVQYRPS*

>peptide 2 (37 aa)
MCNIWHWSLLWLFTEQGSTFLPYIYTTYFNFIPCNNG*

>peptide 3 (30 aa)
KKVKKKPKCVTRRMQNRTGRGRHAISSRRS*

>peptide 4 (30 aa)
MARSPVVILLIYFFFLFLSLELFCKLVLLS*

>peptide 5 (53 aa)
MACLPLPVRFCILRVTHFGFFFTFFSWFLCFSAADVSIVASMALSISPPTYTC*

>peptide 6 (32 aa)
MPASTCSVLHPSGHTLWFLFHLFLLVPLLLCC*

Sequence

>CNT30464658
AAAAAGGTGAAAAAGAAACCAAAGTGTGTGACCCGAAGGATGCAAAACCGAACAGGTAGAGGCAGGCATGCCATTAGTTCACGCAGGAGCTAGCTAGCAC
TTTACTCGCTGCCCGCGGGCTTGTAGGCGATGAAGCTGACGCACTGCGTCTGCTTGATGTTGTCGAAGCCCAGGATGCGGACGTAGGCGTCCGGGTAGGA
CGCGATGGCCTCCTGCAGCTCCTTGTACACCTGCGACGCGTCGGTGCAGCCGAACATGGGCAGCTTCCACATGGTCCAGTACCGGCCGTCGTAGTAGCAC
GGGGAGCTGCAGGAGGCCATCGCGTCCTACCCGGACGCCTACGTCCGCATCCTGGCTTCGACAACATCAAGCAGACGCAGTGCGTCAGCTTCATCGCCTA
CAAGCCCGCGGGCAGCGAGTAAAGTGCTAGCTAGCTCCTGCGTGAACTAATGGCATGCCTGCCTCTACCTGTTCGGTTTTGCATCCTTCGGGTCACACAC
TTTGGTTTCTTTTTCACCTTTTTCTCCTGGTTCCTTTGCTTCTCTGCTGCTGATGTATCCATTGTTGCAAGCATGGCATTATCCATCTCTCCCCCTACAT
ATACCTGCTAGAAACTACTGCAACTAGCGTTGGGTGAGGAACATGTGAATGCAAGCTCCGGCTATCATATATGTGTAATATATGGCATTGGAGTTTGCTC
TGGTTATTCACAGAGCAAGGAAGTACTTTCCTTCCATATATATATACAACATACTTTAATTTCATTCCATGCAACAATGGCTAGAAGCCCTGTTGTAATT
TTGCTTATTTACTTTTTTTTCCTTTTTTTGTCTCTTGAACTTTTCTGTAAGCTGGTTCTCCTTTCTTAATAAATATATGCACAGTAGGGGGAAATCCCTC
CTGTTTCCATCAAAAAA