Detailed information on CNT30464211


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30464211

Peptides detected in this lncRNA

>peptide 1 (40 aa)
GWRRSCTSLRLTMRTHTSSTWPKVGSSSRTSGPCCPTPAS*

>peptide 2 (74 aa)
VETILYVAPSDNADAHIEHLAKGGEFITHLWAMLSNAGILKRATGEWHPPASTTNKEPPKKIEKTKARTQECPF*

>peptide 3 (46 aa)
MASACFHYQQRTTKEDREDQSKNSGMSLLMMKHNQHPPRRFHQLQV*

Sequence

>CNT30464211
GGGTGGAGACGATCCTGTACGTCGCTCCGTCTGACAATGCGGACGCACACATCGAGCACCTGGCCAAAGGTGGGGAGTTCATCACGCACCTCTGGGCCAT
GCTGTCCAACGCCGGCATCCTGAAGCGAGCAACAGGGGAATGGCATCCGCCTGCTTCCACTACCAACAAAGAACCACCAAAGAAGATAGAGAAGACCAAA
GCAAGAACTCAGGAATGTCCCTTTTAATGATGAAGCATAATCAGCATCCTCCACGTCGTTTCCACCAATTGCAGGTGTAAAGGCCCAACGAAGAAGCAAG
CTAAAATTAAGGCTATTTCACAGACCTGCAATGGCTATTAGAACTTTAG