Detailed information on CNT30463276


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30463276

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MCRERCMCRLRYIGGPRGRQCSCARGNGPCFP

>peptide 2 (63 aa)
PDDGRGLHRSSNAIPPAAAEAAAGCPPPQRSKRASSPQRRSPAPHGTSRVSTRSRRRPSPAGT*

>peptide 3 (81 aa)
PGRRPRSPPQLERDSPGRGRSSSGLSTTPALEARELAPAQVPGAARDLPRVHAQPPPPVPGRHVVPQEEAAAAALLQLLLL*

>peptide 4 (86 aa)
ARTTAAVSTAARTRFPRPRPKQQRAVHHPSARSARARPSAGPRRRTGPPACPRAAAAARPRPARSTSGRGCRRRAPPAAPALGHPP*

Sequence

>CNT30463276
GCCCGGACGACGGCCGCGGTCTCCACCGCAGCTCGAACGCGATTCCCCCGGCCGCGGCCGAAGCAGCAGCGGGCTGTCCACCACCCCAGCGCTCGAAGCG
CGCGAGCTCGCCCCAGCGCAGGTCCCCGGCGCCGCACGGGACCTCCCGCGTGTCCACGCGCAGCCGCCGCCGCCCGTCCCCGGCCGGCACGTAGTACCTC
AGGAAGAGGCTGCCGCCGCCGCGCTCCTCCAGCTGCTCCTGCTCTAGGCCATCCACCCTGACGACCCTGACGCCGAGCTCGAGGCTCGGCGGCGGCTGCA
CCCTCAGTCTTGCCATCAGCGCACGCGCGCACTCGATCGCGCCTCGCGCTTCTTCTTGCAGCAAGTTAACTGCATGAACGCAGCAGCACTACTACTAGCT
GGTTGACTCAGCTGCGGTGGTTCGTGTTGGCGCGCTGGGCTGAGCTCATGTGTAGAGAGCGTTGCATGTGCAGGCTCCGATATATAGGCGGACCGCGCGG
ACGCCAGTGCTCTTGTGCTCGTGGAAACGGCCCTTGCTTTCCC