Detailed information on CNT30463203


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30463203

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MSGDWCNGHAWLYGPEVFTYFRGEKIKLE*

>peptide 2 (53 aa)
MHKVIILGNYMRHFYYFDLYFLSVVYCGRFLPYTKQLLVLFHAHIGNSIYRTL*

>peptide 3 (33 aa)
MSFRIWRTCLVTGATGTLGCMALRCLPISEGRK*

>peptide 4 (43 aa)
MESIPTGCSKIMNVNLRLEDKHLVYPKGCQMTEAVCIDFFEPE*

>peptide 5 (89 aa)
MGLPGGNNGLSLDLSDTLGNKYMLFAPYLGSIFFLHGKTNEMGKRQQRFHVSTSGFAFNSCMLTRGLFRRGITPSCSTRSDMGFSQCIK*

>peptide 6 (39 aa)
MITFIVLLVILRDAILGLGSSLLCLCNDIPVFLCNFVKN*

Sequence

>CNT30463203
CTGGATTTCATTTGCATAGATAGCTAGAAGGCCATCGCTGACATACCCGAGGGCCTGCCCGCCATCATCACTACGTGCCTCACGCTCGGGACCAGGAAGA
TGGCTGCTGGTGATTCTTCGAGGTAAAGGCTCTTTTCACTGATTCGGAACGAAGTGAACTTTTGAGAAGACTTAGCGAAGCAAATCAATATAACCGATTC
CTCAAGAGACAGGTTTTGGTTGAGAAAATGGGTCTACCTGGAGGAAATAATGGTCTGTCCTTGGATCTGTCTGATACATTAGGCAACAAATACATGCTCT
TTGCACCTTACCTAGGTTCTATATTTTTCCTCCATGGCAAGACGAACGAGATGGGCAAGAGGCAACAAAGGTTTCATGTGAGTACGTCGGGCTTTGCTTT
CAATAGCTGTATGCTGACAAGAGGCCTCTTCAGGCGTGGAATTACACCTAGCTGCTCGACACGGTCAGATATGGGTTTCAGTCAATGCATAAAGTAATTA
TCCTGGGAAACTACATGAGGCATTTTTACTACTTCGACCTGTACTTCCTCTCTGTCGTATATTGTGGAAGATTTTTACCCTACACAAAGCAATTATTGGT
TCTTTTCCATGCACATATAGGCAACAGCATTTATAGAACACTCTAGCAGATGAAACTCATATGGAGAGCATACCAACTGGTTGTTCAAAAATTATGAATG
TTAATTTGCGTCTCGAAGATAAACATCTTGTATATCCAAAGGGGTGTCAAATGACAGAAGCTGTATGTATTGATTTCTTTGAGCCGGAATAGAGGCATGG
AACTACCGGCCTGCAGCTTCAGCAATCGAGCACATCGAAACAACAGAGCGTGACGAATTTGGCATGTGTCAAGCTGAAGAAAGTTGACGGTCACTGGAGG
TTTAGGTTAGGTGTACATATCTCATACCAAAGGAAATATCCACTTAACTTTTCACAGATTTGTTTGTAGCAAAGAGCTAAAAAATTCTGATTAGGTACAT
GCATACATGACGATTGCATGAGCTTTAGAATTTGGAGGACATGTCTGGTGACTGGTGCAACGGGCACGCTTGGTTGTATGGCCCTGAGGTGTTTACCTAT
TTCCGAGGGGAGAAAATAAAATTAGAGTAGTGTTATTAGGACTTCTAAATACCTACGACTCTTATCTAGATTCCAATGAAACCATCAATTTTCAACACTT
TTAATACTCCACATTTTACTTAGATGCCCTGACAACCGGAGCCTCTAATCTATGAGCAAGGGTCTCTTTGACCGAGAGAGGATGTGAAGTGCATGATCAC
CTTTATTGTACTTCTGGTTATCCTACGTGATGCTATCTTGGGTCTTGGATCGAGCTTACTCTGCTTGTGTAATGATATTCCGGTATTCTTATGTAACTTT
GTGAAGAACTAATATTGATGTAGGGGACATTTATGAACT