Detailed information on CNT30461980


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520004Saccharum spontaneumSetaria italica48.2868.8283.19351forward
CNT307225Saccharum spontaneumZea mays56.2675.687.78409forward

Expression of CNT30461980

Peptides detected in this lncRNA

>peptide 1 (96 aa)
MLGPLAFSSILGAAKDLRRHWHMGTRHAGAAVLGICYSFFWHQEVVVATCSRLGLPVVTCCYFWEEVVVATCSCLGLPVVTCCYFWEEEEAAAVTC*

>peptide 2 (63 aa)
MRSGKTCWAPSHFPASWGQLRISGVIGIWGLVTLGLLSWGSAIASSGIRRWWWRPARVSGSRW*

>peptide 3 (35 aa)
QRYLFSFFAIRLQRYLNIAHDKHFVKFEYKLVIQV*

>peptide 4 (54 aa)
MVLPPQLYQQRCVQGKPKTLEQNLRLDPIELQLYRCARAKHAGPPRIFQHLGGS*

>peptide 5 (36 aa)
MSRAPCGDLLLFLGGGGGSGGDLLRLRARDPGGDLL*

Sequence

>CNT30461980
CAGAGATATCTTTTTTCTTTTTTTGCGATTCGCTTACAGAGGTATCTCAACATAGCGCACGATAAACACTTTGTCAAATTCGAATACAAACTAGTAATAC
AAGTCTAACACGAAACAGGTCTGGTCTTGACAACTACACAAGCGCCCAAAGTCATCCAGTCAATACTTAAAACAGAAACGTTATGGTCCTGCCTCCACAA
TTGTATCAGCAGCGGTGTGTCCAAGGGAAACCCAAAACACTGGAACAAAATCTCAGACTGGATCCTATAGAATTACAGTTGTATCGATGCGCTCGGGCAA
AACATGCTGGGCCCCCTCGCATTTTCCAGCATCTTGGGGGCAGCTAAGGATCTCAGGCGTCATTGGCATATGGGGACTCGTCACGCTGGGGCTGCTGTCC
TGGGGATCTGCTATAGCTTCTTCTGGCATCAGGAGGTGGTGGTGGCGACCTGCTCGCGTCTCGGGCTCCCGGTGGTGACCTGCTGTTATTTCTGGGAGGA
GGTGGTGGTGGCGACCTGCTCATGTCTCGGGCTCCCTGTGGTGACCTGCTGTTATTTCTGGGAGGAGGAGGAGGCAGCGGCGGTGACCTGCTGAGACTCC
GTGCACGAGATCCTGGTGGCGACCTGCTGTAACTTCGCCTCCTAGGAGAACGATCTCGTGGGCTGTAGCTCCTGAAAAACCCAACATTTGTTTTCAGGTT
TAACACAAAATAATCCATTGAAAAGGC