Detailed information on CNT30461553


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30461553

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MIYQRNNELPSVLGCWLLGWYLTHSLPTYLTHWSFD*

>peptide 2 (36 aa)
MSYWCNHWFLLGKPQLPFRQANTLVLCIHSSVTQHC*

>peptide 3 (32 aa)
MVSDPQSANIPYPLEFRLALGINVHPVSVPNH*

>peptide 4 (55 aa)
MLPSQPIISDRLCWCTTVGPALEERLLEMPPIEATLRDQAHRLSPASPLYFALLP*

>peptide 5 (52 aa)
MHHHLFRSSFNPGTSVISLFSVDIKKSCSLLLYFFPQTRRRTAHLCIKKKNG*

>peptide 6 (61 aa)
MGKSPCNTHPHTNTHKRVDIVRALCLQQKRPCDCCIVDLVDNSALEGILLTYNMKEQLRTN*

>peptide 7 (58 aa)
MPSIHFSSGSTFCCWPVCVLHLVAPSMRQELHYLQESHKSIDIPGPAHLNFSSWRAHF*

>peptide 8 (80 aa)
MMVAAECRLEDVGSQLLYFVADSVPPFYIARGQQAPKRNFKAYRFELCSLVYSEVFLSYCRLFTLPVWQDICQRLPCLLR*

>peptide 9 (72 aa)
SRHFDAPSARYKRPATSGRRHISTRSQVTAPCSLDDWMGRTEIAKGCQAFISQAVQHFVAGRSAYCIWWHQA*

>peptide 10 (86 aa)
LDTSMRPAPVIKGRPHPGDGTSAPAHRSQPLAHWMTGWGGRKSRKDAKHSFLKRFNILLLAGLRIASGGTKHEAGTALLARKSQEH*

>peptide 11 (48 aa)
MGKSPCNTHPHTNTHKRVDIVRALCLQQKRPCDCCIVDLVDNSASVPF*

>peptide 12 (39 aa)
MNQLQDHTCGFLASCAVVASSLLPPFARAIGKTGSTVSF*

Sequence

>CNT30461553
TCTAGACACTTCGATGCGCCCAGCGCCCGTTATAAAAGGCCGGCCACATCCGGGCGACGGCACATCAGCACCCGCTCACAGGTCACAGCCCCTTGCTCAT
TGGATGACTGGATGGGGCGGACGGAAATCGCGAAAGGATGCCAAGCATTCATTTCTCAAGCGGTTCAACATTTTGTTGCTGGCCGGTCTGCGTATTGCAT
CTGGTGGCACCAAGCATGAGGCAGGAACTGCATTACTTGCAAGAAAGTCACAAGAGCATTGATATTCCAGGACCTGCGCACTTGAACTTCTCTTCGTGGA
GGGCACATTTCTAAAATTTGACGGCTATGTTTAAAAGTATAGATCGGTGATATGAAAGTTCCATCACTGTCTTCTTTTGGTTAATGCACATTCGAAGTAA
GGCATTTGTTTGAATAATCATTAAACAAAATTTTGTTCAATTTACTCTCCCCTAACTATTTCAAATAGATTTGTCTTTTTTTTTATTTTCCATGTACAAC
AGTACAAGTTGAGTTTGAAGTTTCAAATGATGTGGGTTCATAGAAGACACCATAATTTATGTTAAGAAAATATATCATGAATTTTTAATCATTATTTTGA
TAGCTTGTAATATAATAATGTCTAATCATAAATTAACCCTAGACATCTACAAAATCTTATGAAAAATGAATCATGTATTTTGTCAACATAATTTATGGTG
TCTGCTATCATCACCCACATCATTTGAACTCCAAACTTAATTTGCACATGGGGAAATAAAAAAAGGAAGTCGTATTAAGGCATAGATTTGACCAACAGAA
GTAGTTGGAGGGAGTAAATTGAACCAAAGTTTTGCTTAGGGGTTATTCAGAAAAAGGCCTTGAGGGAAGTAATTCAACAAAATTTCCCAATAAAGTAAGT
TGTTCGTGAAATGTCAATTAGCATCAAATAAAGAATGGAGAGAATATTATAGTGGGCACATCCACTTTAATGTCATATTGGTGTAACCATTGGTTCCTAT
TGGGGAAACCACAACTTCCCTTTCGGCAAGCAAACACTCTGGTACTTTGTATTCATAGTTCAGTTACCCAACACTGTTGATAATCGTTACAGAATTACAT
ATTCAAATCTTGATTAATTGATAGAATAATTGTTTGCCACACTGGCCAGAAGCCCCAAAGGTTGTAACTTGCAAGCCAATATGATAGGCACCAAGTACCT
ATTAGCAGCCCTCAACATGCATGTGAACCAATGATCTACAGAGTATCGTACTGAAGCTGTGACCCTGTAAATCCTTTCAAACAGGAAAAAAGAATTATCT
TCCTTAATCTATAATTGTCAAAACATATAGACTGAAATTGGGATGACCAACCATATTATTACCATGTTTGATTGTTGATTACAAATCTTGAGAACCAAAT
AAAATTCTTGGGGCAGCGGAGCAAAATGGGTACTTATAGCCAGCGGTGATGCCACGTTGCTGTAGGGTGGTTCACTGGTACCAGGCAAGAAAAAAATGAG
CGCTAAATAGCTCACTTTGAAAATTTTAAGCTGTTCCAATTTAGCAATCTGCTTCAAATTTAGACATGCTTCTATAGTTATGCACCACCATCTGTTCCGT
TCTAGCTTCAACCCTGGTACTAGCGTCATTTCTTTGTTTTCAGTGGATATAAAAAAATCGTGCAGTTTATTGCTGTATTTTTTTCCTCAAACACGCAGGA
GAACTGCACATCTTTGTATTAAGAAGAAAAATGGGTAAGAGCCCTTGCAACACACACCCACACACCAACACACACAAGAGAGTAGACATCGTTCGCGCCT
TATGCTTACAACAAAAGCGACCTTGTGACTGTTGTATTGTTGACCTTGTAGATAATTCTGCATCTGTTCCGTTCTAGCTTCAACCCTGGTACTAGCGTCA
TTTCTTTGTTTTCAGTGGATATAAAAAAATCGTGCAGTTTATTGCTGTATTTTTTTTCCTCAAACACGCAGGAGAACTGCACATCTTTGTATTAAGAAGA
AAAATGGGTAAGAGCCCTTGCAACACACACCCACACACCAACACACACAAGAGAGTAGACATCGTTCGCGCCTTATGCTTACAACAAAAGCGACCTTGTG
ACTGTTGTATTGTTGACCTTGTAGATAATTCTGCACTGGAAGGTATATTGTTGACTTACAATATGAAAGAGCAGCTAAGGACCAACTAATATGATTTATC
AAAGAAATAATGAGCTCCCTTCAGTGCTGGGCTGCTGGCTGCTGGGATGGTATCTGACCCACAGTCTGCCAACATACCTTACCCACTGGAGTTTCGACTA
GCATTAGGGATAAATGTGCATCCAGTTTCAGTTCCAAACCATTAAACTTGTACTAGTCCTTATTGTAAAGTTCAGTCATCAGTGAAGCCAAATCCATATA
CATCATGCAAATGCCAAACTGAAACCCAGTGTATCTTCAATGTGGAGGAGCCTCACGTGACATTATTGATACTACCTGGGTCCTGTACACAAGCCATTTT
GCTCACTCAGCTAGTATATTTCACAAATACTTATTGCAACCAGAGTGCTCTGCATTGTCTGAAATTGTTGAAACACCATGAATCAATTGCAGGATCATAC
TTGTGGCTTTCTTGCAAGTTGTGCAGTTGTTGCCTCAAGCTTGCTGCCTCCCTTTGCCAGAGCTATTGGTAAAACAGGAAGTACTGTCAGTTTCTGAGCT
ACAAAATATAAGTGTAGAAAAATAATTTAGAAATATTAACAGGATTCAATCAGTTGTTGCTGGGGTAGTCTACAGCAAATACATGGGTTTTCTTTATTGA
AAGCTAACATGCCTTTGCTTCCGTGCATTCTCTTTTGAGAGGCAATGAAGTGGACCATCGGATGGAGATCTGACTGTCCATGCTGATAGAAGCTGGCTTT
TGAATCCCTCTTCCTACTGCCATCTCCAACGGTGTTGGAGCATGCTCCCCAGCCAACCGATCATCTCTGACCGTCTCTGTTGGTGTACCACTGTCGGGCC
GGCCTTGGAAGAAAGACTCTTGGAGATGCCTCCAATTGAAGCTACTCTGCGTGACCAGGCCCACAGGCTGTCTCCTGCATCACCGCTGTACTTCGCCTTA
CTGCCCTAGCACCACTGGACCGATTCCTGAGCCAGGAGCACACCAAAACCTCGTCATTTCTGAAACTTCAGTTCTAGTGACGATGATGGTGGCTGCCGAA
TGCCGGCTTGAAGATGTGGGCTCCCAACTGCTGTATTTCGTAGCTGACTCGGTGCCCCCCTTTTACATAGCACGTGGCCAACAAGCACCAAAGCGTAACT
TTAAAGCCTACCGCTTTGAACTTTGCAGCCTCGTATATTCAGAAGTTTTCTTGAGTTATTGTAGACTCTTTACATTGCCTGTTTGGCAAGACATTTGTCA
GCGACTACCTTGTTTATTAAGGTGAAACGCCTCTTCTGTAGTGTTTAGCTTGTTGTTTTGAGGACAATTTCCTTGTATTGAACTAATGTGGCAAAATTGT
ATATCAAATTC