Detailed information on CNT30461176


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 7e-127

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30693916Saccharum spontaneumOryza sativa25.959.1486.75883forward
CNT30674319Saccharum spontaneumSetaria viridis24.0582.2589.39820forward
CNT30519947Saccharum spontaneumSetaria italica19.8677.6489.96677forward
CNT30528977Saccharum spontaneumEucalyptus grandis26.7868.1386.09913forward
CNT30191529Saccharum spontaneumSecale cereale27.0253.2188.49921forward
CNT30305252Saccharum spontaneumTriticum aestivum22.7690.8787.24776forward
CNT30553671Saccharum spontaneumOryza glaberrima26.8778.7686.14916forward
CNT30242602Saccharum spontaneumAvena sativa27.0280.5889.79921forward
CNT30142111Saccharum spontaneumLolium perenne27.0574.689.48922forward
CNT307928Saccharum spontaneumZea mays34.0697.491.041161forward
CNT30229606Saccharum spontaneumAnanas comosus26.9669.3685.96919forward
CNT30652285Saccharum spontaneumRosa chinensis26.9375.4384.97918forward
CNT30716337Saccharum spontaneumMalus domestica golden26.7573.6184.54912forward
CNT30684712Saccharum spontaneumTriticum urartu26.7535.6489.69912forward
CNT30722465Saccharum spontaneumTriticum spelta24.4173.6987.86832forward
CNT30364163Saccharum spontaneumSorghum bicolor19.8373.6494.23676forward
CNT30595768Saccharum spontaneumOryza meridionalis27.1367.2787.78925forward
CNT30110940Saccharum spontaneumOryza longistaminata25.932.5686.75883forward
CNT30583684Saccharum spontaneumEchinochloa crusgalli21.1834.491.14722forward
CNT30116852Saccharum spontaneumOryza nivara27.1377.8686.16925forward
CNT30604148Saccharum spontaneumOryza punctata20.0180.6188.56682forward

Expression of CNT30461176

Peptides detected in this lncRNA

>peptide 1 (53 aa)
MPSLSWILAFTLSMVSELSTSRVMVLPVKVFTNICMPPLRRSTRWRVLSFWML*

>peptide 2 (86 aa)
MEVHQRAPDRRRYSSSLNDPWLTDHHGDEAPGGGCSPSGYCSLLGYGHPPAACRRRSDAAGPGGCPPCPGSWPSRCQWCRSSQPPG*

>peptide 3 (86 aa)
MHASPEAQHQVEGALLLDVVISKSAPVLRLLAGEDEPLLVRGNALLVLDLSLDVVNGVRRLHLEGDSLAGEGLHKDLHLQGNQTKG*

>peptide 4 (59 aa)
MLLAVTMQYLTHYGNPLLQLSMSFLPSWLCRLLCWSPIQASPGNRQPPSQVSIDNISLN*

>peptide 5 (84 aa)
MSRCWSGGMPSLSWILALTLSMVSEDSTSRVIVLPVRVFTKICICKETKQKGKHIVVDQGGKAKQQYKIYMHAQTCRCHRIKEQ*

>peptide 6 (61 aa)
MSRCWSGGMPSLSWILALTLSMVSEDSTSRVIVLPVRVFTKICMPPLRRSTKWRVLSFWML*

>peptide 7 (52 aa)
MKNFSGQCMEQEGARPSLPSTALRLHSNEQPTTFYSAQCFGEIKEPCCLLLQ*

>peptide 8 (52 aa)
MPSLSWILALTLSMVSEDSTSSDRLPVRVFTKICMPPLRRSTKWRVLSFWML*

>peptide 9 (33 aa)
MITETLKPTEIYRREKNNHTYKSKDMNPDHLNK*

>peptide 10 (34 aa)
MCITYMAKRGAKPRRPICQIEFTFNKLTLLLYVW*

>peptide 11 (39 aa)
MCIYGSVYSPIFWSDNLSTSSVDVIKLLSYIGCYCLQKT*

>peptide 12 (48 aa)
MTLRAKSEDSFEILCLNFSNQDRKACASTVLCILQYFGQITCLLHQLM*

>peptide 13 (49 aa)
FFFCLLRPKSKMENEYLFAKNFAWCLVSFSKMMDQNTKLFGRNGELNTP*

>peptide 14 (50 aa)
MVFSFIQQNDGPKHKTFWTKWGTKHTLNTAKVIVEARNQTEPAQSGSDCL*

Sequence

>CNT30461176
TTTTTTTTTTTGCCTCTTGAGGCCAAAATCCAAAATGGAGAATGAATACCTTTTTGCCAAAAATTTTGCATGGTGTTTAGTTTCATTCAGCAAAATGATG
GACCAAAACACAAAACTTTTTGGACGAAATGGGGAACTAAACACACCCTAAACACAGCCAAAGTTATTGTGGAGGCTAGAAATCAAACTGAGCCTGCTCA
ATCAGGAAGCGATTGTTTATAGGCCAAGAACATCCATCCATGATCCATCAGTTTTGGTCGTAAGACTGTATTTAATCAACAAGGAGTGTTCAATATCAAC
TATGCTTCTAGCAGTTACCATGCAGTATTTGACACATTACGGCAACCCTCTCTTGCAGCTATCCATGAGCTTCCTGCCTTCCTGGTTATGCCGTCTGCTT
TGCTGGAGTCCCATACAAGCTTCCCCTGGAAACCGACAACCTCCTTCACAAGTCTCAATAGATAACATTAGTTTAAATTAGTGGACCAAATTAAACATTC
TTTTTGTTTTATTAAGGTGGAGCAATTTTTTTCCTTGTTTTGAAGCCAGAAATTTTTATCTATATAGTAAGCTAAGAAATCTGTTTAACATTTTGATAAA
ATCATCACTGGGTTAGCAGCAAAAGGAACGCTGAAAGACATCATCTCGACGATATATACGTTTCATTCCTCTGCATTGATTTAAGCATTACAATTGCATT
ACAGTTTATGGATTTTTTCTTGTGCACTCATTCTTGACATACTGTAAGATCAATCAACATTTTGGAAAGGAGTGAGCCGAGACTGGCAAGCATGTGCATC
ACCTACATGGCGAAGCGTGGTGCCAAACCAAGACGGCCAATCTGTCAGATTGAGTTTACATTCAACAAGCTAACACTACTTTTATACGTCTGGTAGAAAT
GCTAGGAAGCACAGATGAAAAATTTCAGTGGACAGTGCATGGAGCAAGAGGGGGCTAGGCCCAGCTTGCCCTCCACAGCCCTCCGCCTGCACTCTAATGA
GCAGCCAACGACATTCTACAGTGCTCAATGTTTTGGTGAGATAAAAGAACCTTGTTGTCTACTACTTCAGTAGATGCGATCAAGTTACCGTCTTGTAGCC
ACTTTGTCTCCAGAAAACATAAAGCCACAGCCTCCAAATGAATTATGATCACAGAAACACTGAAGCCTACAGAAATTTACCGTCGTGAAAAAAATAACCA
CACTTACAAGAGTAAAGATATGAATCCGGACCACTTAAATAAATAATACTATTCTGCACAATCCTACACGTTCTTTTGGATTTAGCAAGAACTAGCAATC
AGAACCCAGTAATATAGCAACAAACTGTAAGCCAGAGTAAAAAAAACAGAGCTTTCCAGATCCTGTAAGCCATCACAACAGTTTTGGGTAGAACACACTA
GGACAACCGGTCCATTAAACCAAACTCAGTCACGACTCATGACTTTGAGAGCAAAAAGTGAAGACAGCTTTGAGATTTTGTGCTTAAATTTCTCGAACCA
AGATCGGAAAGCATGTGCATCTACGGTTCTGTGTATTCTCCAATATTTTGGTCAGATAACTTGTCTACTTCATCAGTTGATGTGATCAAGTTGCTGTCTT
ACATTGGATGCTACTGTCTCCAGAAAACATAATGATCACAGAAACACTAAAGCATCCAGAAAATTTACCCTTGTAGAAAAATCTCAGTAGACTCCTTAGC
TAGAAGATTCCTTCACAGTAATAACATGGATCACTCAAATAAATCAAATGGTTCAGCAAAATACCACATATCTTTTGGATTCAGCAAGAACTAGCGATCA
GAACCCAACAACATAGCAACAACCAATCAAACATGTTAAGCTAGAATAAAAAACTGAGCTTTGACAGAAGCAAGTTGACATCCAACAAACCATCAAACAT
GTCAAGCTAGCTAGAGTAAAAAACTGAGCTTGACAGATCCAAGTTAATATCCAACAAACCATCAAACATGTTAAGCTGTAAGCCAGAGTAAAAAGCTGAG
CTTGACAGAACCAAGTGACCATTCGGTAAGAAACGGTAGATGGCGAGAACCCGGACGTCCAATTAACACCAGCCAATCAAATTTGATCTCAGGCAAATAT
TTGGAGATATAACAAAACAAAACACATTGAGCACAAACTTTTAAGTTCAAACATCAAACTTATTCATGATTCAAGCCATACTGCTGTAGAACAGTTTTGG
GTATAAAACACACAGGACACAACTGGCCCTTTAAACCAACTTAGTACCGACTCATGACACAAACCACAGATACTTAATAGACGACAACCTTCCATATGGA
GGTACACCAGAGGGCACCAGACAGACGCAGGTACAGCAGCAGCTTAAACGACCCATGGCTTACTGACCACCACGGAGACGAAGCACCAGGTGGAGGGTGC
TCTCCTTCTGGATATTGTAGTCTGCTAGGGTACGGCCATCCTCCAGCTGCTTGCCGGCGAAGATCAGACGCTGCTGGTCCGGGGGGATGCCCTCCTTGTC
CTGGATCTTGGCCTTCACGTTGTCAATGGTGTCGGAGCTCTCAACCTCCAGGGTAATGGTCTTGCCAGTCAAGGTCTTCACAAATATCTGCATGCCACCC
CTGAGGCGGAGCACCAGGTGGAGGGTGCTCTCCTTCTGGATGTTGTAATCCGCAAGGGTGCGGCCATCCTCCAGCTGCTTGCCGGCGAAGATAAGACGCT
GCTGGTCCGGTGGGATGCCCTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATGGTGTCCGAGGACTCCACCTCAAGTGATCGTCTTCCAGTAAGGGT
CTTCACGAAGATCTGCATGCCTCCCCTGAGGCGCAGCACCAAGTGGAGGGTGCTCTCCTTCTGGATGTTGTAATCAGCAAGAGTGCGCCCGTCCTCCAGC
TGCTTGCCAGCGAAGATGAGCCGCTGCTGGTCCGGAGGGATGCCCTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATGGTGTCAGAGGACTCCACCT
CAAGGGTGATCGTCTTGCCAGTAAGGGTCTTCACGAAGATATGCATGCCTCCCCTGAGGCGCAGCACCAAGTGGAGGGTGCTCTCCTTCTGGATGTTGTA
ATCAGCAAGAGTGCGCCCGTCCTCCGGCTGCTTGCCGGCGAAGATGAGCCGCTGCTGGTCCGGGGGAATGCCCTCCTTGTCCTGGATCTTAGCCTTGACG
TTGTCAATGGTGTCAGAAGACTCCACCTCGAGGGTGATAGTCTTGCCGGTGAGGGTCTTCACAAAGATCTGCATCTGCAAGGAAACCAAACAAAAGGGTA
AGCATATAGTAGTAGACCAAGGAGGAAAAGCAAAGCAACAATATAAAATATATATGCATGCTCAAACATGTAGGTGCCACAGAATCAAGGAGCAGTAGCA
GCATGCCAC