Detailed information on CNT30461142


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30461142

Peptides detected in this lncRNA

>peptide 1 (99 aa)
LGAGTSLPGLVAAKVGADVTLTDIAHNAEVLNNIRSICALNNANCTVSGLTWGDWDEPVFDLHPDIILGADVLYDSANFDDLFATVTFLLENSSGAVFIT

>peptide 2 (30 aa)
MNRYLIYILTLFLELMYFTTQQILMICSRR*

Sequence

>CNT30461142
AGCTTGGTGCTGGGACCTCACTGCCGGGATTAGTAGCTGCAAAGGTTGGGGCAGATGTAACACTAACAGACATTGCGCATAATGCAGAAGTACTAAACAA
CATCAGAAGCATATGTGCTCTCAATAACGCCAACTGTACTGTTTCAGGACTTACGTGGGGAGACTGGGATGAACCGGTATTTGATTTACATCCTGACATT
ATTCTTGGAGCTGATGTACTTTACGACTCAGCAAATTTTGATGATCTGTTCGCGACGGTGACCTTTCTTCTCGAAAATTCTTCTGGGGCGGTTTTCATAA
CCAC