Detailed information on CNT30460862


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 7e-102

BLAST vs NONCODE:
NONMEST001181, E-value = 2e-77

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30460862

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MSRCWSGGMPSLSWILALTLSMVSEDSTSRVIVLPVRVFTKICICRRIT

>peptide 2 (86 aa)
MEVHQRAPDRRRYSSSLNDPWLTDHHGDGAPGGGCSPSEYCSLLGYGHPPAACRRRSDAAGPGGYPPCPGSSPSRCRWCQSSQPPG*

>peptide 3 (40 aa)
MVSELSTSRVMVFPVKVFTNICMPPLRRSTRWRVLSFWML*

Sequence

>CNT30460862
ATAAACGAAAAAAAACCATATTGAACACAAACTTTTAGTTCAAACATCAAACTTATTCATGATGAAGCCATACTGCTGCAGAACAGTTTAGGTATCACAC
ACACAGGACACAACCGGTCCTTTATTAAACCAACTCTCAGTCACGACTCATGACACAAACCACAGATACTTAATAGACGACAACCACCATATGGAGGTAC
ACCAGAGGGCACCAGACAGACGCAGGTACAGCAGCAGCTTAAACGACCCATGGCTTACTGACCACCACGGAGACGGAGCACCAGGTGGAGGGTGCTCTCC
TTCTGAATATTGTAGTCTGCTAGGGTACGGCCATCCTCCAGCTGCTTGCCGGCGAAGATCAGACGCTGCTGGTCCGGGGGGATACCCTCCTTGTCCTGGA
TCTTCGCCTTCACGTTGTCGATGGTGTCAGAGCTCTCAACCTCCAGGGTAATGGTCTTCCCAGTCAAGGTCTTCACAAATATCTGCATGCCACCCCTGAG
GCGGAGCACCAGGTGGAGGGTGCTCTCCTTCTGGATGTTGTAGTCGGCAAGGGTGCGCCCGTCCTCAAGCTGCTTGCCGGCAAAGATGAGCCGCTGCTGG
TCAGGGGGGATGCCCTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATGGTGTCAGAAGACTCCACCTCGAGGGTGATAGTCTTGCCGGTCAGGGTCT
TCACAAAGATCTGCATCTGCAGAAGGATCACCA