Detailed information on CNT30459997


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30459997

Peptides detected in this lncRNA

>peptide 1 (84 aa)
VAFPSLRRPPVGLAWLCLVASASCQASKLPLARRPSAAASIYPARSARSSYPLIAAPCLNFSSSPASRLGTALSSHFPSLGDCI*

Sequence

>CNT30459997
GTTGCCTTTCCTTCGCTTCGACGGCCACCTGTTGGCCTCGCATGGCTCTGCCTAGTAGCTAGTGCCTCCTGCCAAGCGTCCAAGCTCCCGCTCGCCCGGC
GGCCAAGCGCCGCGGCGTCTATATATCCAGCCAGATCCGCGCGATCTAGCTATCCCCTAATCGCCGCACCCTGCCTCAACTTCTCTAGCTCACCCGCATC
CCGGCTCGGCACGGCCCTCTCCTCGCACTTCCCTTCTCTGGGTGATTGCATCTAGCCCCATCATAACAATTCATCGGCAGCGGCGCGCCATCGTCGTCTC
AGATTGATGCAAGGGGTGGTGACAAGCTAGAGGCAGCAACTGCATATCTTGCAAGAAAATTGGTTTTCGAACCATACCGATAATTTTCTTGCAAGTTGTG
CAGTTGTTGTCTCAAGCTTGCTGCCTCCCTTTGCCAAAACTATGAACAAAAGCACAGGTTATGTTATCAGTGAACACATTGACACAAATTTGAACTGATA
TATGTTGATAACAGACGTGACGTTTAATTGGAATCTTGCAGCATGATACACACACAGCAGCTCTTAGGTACTCCCTCCATTCCAAATTATAAGACGTATT
GGGTTTTGTAGACACATTGATTTTACTATGTATCTAGACATAGCATATATCTAAGTGTATAGCAAAAGCTATGTCTAGAAAAGCCAAAACGTCTTATAAT
TTTGGAATGGAAGGAGTACGAAACTAATCGGGAATGATGTTTGTTACTAGAACTAGAAATTGCACTTCGACTTGTCCAAATGTGGAGGCTATTTTAATGT
GACTTTGCTTACTTTTGGATCAACAAGCAGTATGTTAAGGTATTGCAGCGGGTACTGTTGTGCTACGATGTTGCAAGCAGACTCCATGAAGTCATAATAA
GGTGAGTGGAAATTCTTATAAGAACATGTCAGTATAAGTAAATGATCTCCTGATTTTATGATTTGAGGGGTGCTGATTGCCTTTCAGTCAGTGCTAGTTC
TTCTGCCGTTACGTGTTCAGAGTGTTCAGTATCTATTCTACGGCAAGCTTTGATGTTAGCTTGCACACTATTCCAACTTAATTTCACTGTTATGTGCATT
TTAGAGCACAATTAGCAGGCTGGATTGGCATGCATAGTTTCATTCTACGTTCTTTGTTTTGCAAGGTCGTAGAAGACTAGAAGGCATATTTGAGGGCAGT
TTCTGGCGTGTAAACTATCCAGCCTGTGGCATGGTACTTCGGAGTTTATGGGATGTTCTGCAACAGCACTAGAATTTTGACAATCTAGTGTCATGTGTGA
CACAACTGAAGTGGCAAAAAGAATTCCAATTTAAATAACATCATTGGATAAGGCATCTGCTGACATCTGGTTTTCGTGATGCAAGATGAGTTCCAATTGA
CATAATACAGTAGTAGAATAAGTTCGTACGACAGTGTTCTCTGTTGGATCTCCTAATTAACTTTTGTGAAAAAGGCTAACGGGTGTGTGAAGGATTCCTA
GTTCACCAACATGTAAATAAGAATGCATTGATGTTTTGTTGTTAAT