Detailed information on CNT30459759


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30519958Saccharum spontaneumSetaria italica32.8535.0287.7890forward

Expression of CNT30459759

Peptides detected in this lncRNA

>peptide 1 (89 aa)
PSPRRPRGRVPRDQHEPRRRRPRPRPRREPRRRGGARGVEDGAGTARHAGHCRREGEACRDADHGRRWSGAGAGAGTAAGLIWFGGFAAG

>peptide 2 (90 aa)
PQPPPPPRQSTARPARASPAAPAPTASPGTAPTRRGPRRGRRRRDGKARGTLPARGRSLPRRRPWPAVVGRGRGRGHGGRPYLVRGFCRGK

>peptide 3 (90 aa)
PPAPAAPEAEYRATSTSLAGGARAHGLAGNRADEEGPAAWKTAPGRQGTRDTAGARAKPAATPTMAGGGRARARARARRQALSGSGVLPRE

Sequence

>CNT30459759
CCCCCAGCCCCCGCCGCCCCCGAGGCAGAGTACCGCGCGACCAGCACGAGCCTCGCCGGCGGCGCCCGCGCCCACGGCCTCGCCGGGAACCGCGCCGACG
AGGAGGGGCCCGCGGCGTGGAAGACGGCGCCGGGACGGCAAGGCACGCGGGACACTGCCGGCGCGAGGGCGAAGCCTGCCGCGACGCCGACCATGGCCGG
CGGTGGTCGGGCGCGGGCGCGGGCGCGGGCACGGCGGCAGGCCTTATCTGGTTCGGGGGTTTTGCCGCGGGAAG