Detailed information on CNT30458968


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6Z345|DOF4_ORYSJ, E-value = 1e-32

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3084275Saccharum spontaneumVigna radiata23.3510.4291.392forward
CNT30231418Saccharum spontaneumAnanas comosus28.689.9484.07113forward
CNT30685965Saccharum spontaneumTriticum urartu20.331.8798.7580reverse complement

Expression of CNT30458968

Peptides detected in this lncRNA

>peptide 1 (87 aa)
AALGPVPAAALAEVPRLRQVVVVVVAELGVGGLAPRALDRRGRDAAAPRSGALLRMRLGATEVGGPCPAEQPPRQAWDGLELLHDGV*

>peptide 2 (38 aa)
RRPWSSTGGSSCRSAAAATGCSCCSSRTWCWWTRTAGT*

Sequence

>CNT30458968
CGCCGCCCTTGGTCCAGTACCGGCGGCAGCTCTTGCAGAAGTGCCGCGGCTGCGACAGGTTGTAGTTGTTGTAGTAGCAGAACTTGGTGTTGGTGGACTC
GCACCGCGGGCACTTGACCGCCGCGGGCGAGACGCCGCCGCACCGCGCTCCGGGGCCCTGCTGCGCATGCGCCTGGGCGCGACGGAGGTCGGCGGCCCCT
GCCCCGCCGAACAGCCGCCCCGCCAGGCCTGGGATGGACTGGAACTCCTGCATGATGGCGTCTAGCGGCGCGTCGTCTACAACTACAACGTGCTAGGATA
GGGCCTCGGCGGGCGTGAGTGTGTTTGCTGGTGTGTGTTTGCCGGGGAGCGCGGGAGCGTGGCAAGAGCTCCACCCGCTCGGCATCGCCTCTGC