Detailed information on CNT30457432


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30457432

Peptides detected in this lncRNA

>peptide 1 (66 aa)
PTRHPTFRGDLITLTNTQQSTYAHAPRRTDRSSITGNPSAHYSSLIGFEVISSRLLIHNKARTHTH*

>peptide 2 (73 aa)
MMNLPLPGLMAATKKKRTLKMTSGSISLMGTPVSMLSCANAPFPVMISPMMEKATPSCASRPTNSSFDLVNPNS

>peptide 3 (50 aa)
TQHDTLPFEVISSRLLIHNKARTHTHRDALIDHQSQVTQAHTTHHSSGSR*

Sequence

>CNT30457432
ACCCAACACGACACCCTACCTTTCGAGGTGATCTCATCACGCTTACTAATACACAACAAAGCACGTACGCACACGCACCGAGACGCACTGATCGATCATC
AATCACAGGTAACCCAAGCGCACACTACTCATCACTCATCGGGTTCGAGGTGATCTCATCACGCTTACTAATACACAACAAAGCACGTACGCACACGCAC
TGATCGATCATCAATCACAGGTAACCCAAGCGCACACTACTCATCACTCATCGGGTTCGAGGCCAGCATCAATCAGCCTACTCTTCGTCCTCGCCGATGA
TGAACCTGCCGTTGCCGGGGTTGATGGCGGCGACGAAGAAGAAGAGGACGTTGAAGATGACGAGCGGCTCGATCTCGTTGATGGGCACCCCCGTCTCGAT
GTTGAGCTGCGCCAACGCGCCCTTCCCCGTGATGATCTCGCCGATGATGGAGAAGGCCACGCCCAGCTGCGCCAGCCGCCCCACGAACAGCTCGTTCGAC
TTGGTGAACCCAAACAGCG