Detailed information on CNT30457352


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9XI93|NDRP2_ARATH, E-value = 1e-14

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30457352

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MNAYTTYSVFLIIKRLVEKHTATTATTFSVITQTT*

>peptide 2 (98 aa)
MELRSSSIYLRKPWAILNSPPPAPPPALSSPPPCFPTSCSAPFTTSPRPNPSDDLPPSSAAGAGTAGSLVASASAGFGGAASPGCSAPAACPVLNSFR*

>peptide 3 (65 aa)
MYCPAGLSSNLPYVDAACRISDAAPATSFLSTFSALFCWNTDAAASATSLPLENRLPELLPSAIG*

>peptide 4 (69 aa)
ICCERKTLFYSWLILANKQYECLYNIQCFFNYQKTGRKAHCHHCYNVLGYYTDNLKNTRRRQHYLKLIT*

Sequence

>CNT30457352
TAATTTGTTGTGAGAGAAAAACATTATTCTATAGTTGGCTGATTTTGGCCAATAAACAGTATGAATGCTTATACAACATACAGTGTTTTTTTAATTATCA
AAAGACTGGTCGAAAAGCACACTGCCACCACTGCTACAACGTTCTCGGTTATTACACAGACAACTTGAAGAACACACGGCGAAGGCAACATTATTTGAAG
TTAATTACATAACAGACACACAGCTACACGTTGGCCAGAGAAATCAAGTGCAGTTTGTGGATGGAGCTTAGATCGAGTTCCATCTACTTGAGGAAGCCCT
GGGCCATCTTAAACAGCCCACCGCCGGCGCCGCCGCCGGCGCTTTCCTCCCCGCCGCCCTGCTTCCCCACGAGCTGCTCAGCGCCCTTCACGACGTCGCC
GAGGCCAAACCCCTCCGACGACTTGCCGCCTTCATCCGCGGCCGGCGCAGGCACCGCCGGCTCCTTGGTCGCCTCGGCCTCCGCCGGCTTCGGCGGCGCC
GCGTCGCCAGGCTGCTCGGCGCCGGCGGCGTGTCCCGTGCTGAACTCCTTCAGGTAGCCCTCGGCCTTCTCGATGTACTGCCCGGCCGGCTTGTCCTCGA
ACTTGCCGTACGTGGACGCCGCGTGCAGGATCTCGGACGCCGCGCCGGCGACCTCCTTCTTGTCGACGTTCTCCGCGCTCTTCTGCTGGAACACCGACGC
GGCGGCCTCCGCGACCAGCTTGCCGCTGGAGAACAGGTTGCCGGAGTTGTTGCCCTCTGCCATTGGATAGCTTCTCTGCTTGCTCAGATCTTTTTCGCTT
CAGACTTCAGAGCTGCGGTGAGTGAGGCGCAGATAGTGAGGACGCCACTAGCTAGCTACTATCTAGCTTTTTTTTTTTTTGACAACAACAACTACTACTA
TCTAGCTTTATAGGCGAAAGAGGATTAGAGGAAGAGCTGGGCACTAGAACGATCGAAAGCTACTTTTCTGGATTTGATGGTGGAGAGACATGATATCTGC
CGTGAGAAAACAATAAAGCTATG