Detailed information on CNT30456637


BLAST search results

BLAST vs Swiss-Prot:
sp|Q4R1I9|ANGLT_ROSHC, E-value = 5e-65

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30290920Saccharum spontaneumTriticum aestivum6.9429.1887.882forward
CNT30594197Saccharum spontaneumEragrostis curvula4.1520.0893.8849reverse complement

Expression of CNT30456637

Peptides detected in this lncRNA

>peptide 1 (41 aa)
MAHYGDGPTQVRVLESAGLVNEMSIGIWNSRRRPWRIKRSGA

>peptide 2 (60 aa)
MRRTAFPAWLPFRISSGNSEALNGGAPGKERTESPPVVSSWKAIMRGRLRKTASVLAPEA*

>peptide 3 (41 aa)
MQYTGGVERSGTHRPSLRARTARVSSDSKVLTRIPLASGNR*

>peptide 4 (36 aa)
VLGPIQETLREEGLEVRLREWLTHVLRVVSWAPHYP*

Sequence

>CNT30456637
CTGTCCTTGGTCCTATCCAAGAAACCCTCCGGGAGGAGGGACTTGAGGTCCGGCTCCGGGAGTGGCTGACTCACGTCCTGAGGGTTGTTTCGTGGGCTCC
GCACTACCCATAGAAACCTCTGCCCTGACTTCTCGAGCCCAATAGCCATCTCCTCAAGTTGCTTCTTTGGGAACGTGCCCAAGCTCCCAAAGGAGAGGAA
CACGACGCTGTTGTCTGGCTGCATGTCCAGCCACCGGAGGCACTCGTGATCCTTTTCTCCGCCTCCCGAAACCAGCGGCCCGATGCAGTACACCGGCGGC
GTGGAACGGTCGGGAACGCACAGGCCGTCCCTCAGGGCCCGCACAGCCCGCGTCTCCAGCGACTCGAAGGTGTTGACGAGAATCCCGTTGGCCTCTGGGA
ACAGGTAGAGCATGCGGAGGACGGCCTTTCCTGCCTGGCTGCCATTCCGAATCAGTTCGGGCAATTCCGAAGCTTTGAACGGAGGAGCGCCGGGCAAAGA
GAGGACGGAGTCGCCGCCGGTGGTCTCCAGCTGGAAAGCCATCATGCGAGGCAGGTTGAGGAAGACGGCCAGTGTGCTGGCGCCCGAGGCGTAGAAGTAG
TAGACGGGCAGGTTGAGCTCGGCAGCGACGCCGAGCGCGTCGCCGCAGAACATGTCGACGACGAGCGCGTCGACGGCTGGCAGCGAGCGGAGGAGGTCGC
GCAGCGGCGCGTTCATGGCCTTGAGGTAGCCGAGCATCTGGACGACGCGGTCCGAATGCGTGTCATCCGAGCTGGAATCAGGCGGCGGCGGCGGCGGCGG
CGGCGGTAGGACGTGGAAGTTCACGGACGGATTGGAGGCCGCGGCGCGGGCGGCCGCTGCGGAGAAGTCGGCGGACTTGGTGGGCGGCTCGGCGAGCGCG
ATGTGACGGCGACGCCGTGCTGGGTGAACAGCTTGGCCAGCTCGACCATCGGCGTCAGGTGGCCGACGCCGAGGCCCGGGTACAAAACCACGCTCTTCTT
GCTCATCGCTGGACGATTCACACCTCAGAACTGAGAACTCCCTGCTGCTGCTGCTATGGCACACTACGGGGACGGACCTACGCAGGTACGTGTGCTCGAG
AGCGCTGGATTGGTGAATGAAATGTCTATTGGAATCTGGAATTCACGACGCAGACCATGGCGTATAAAACGGTCGGGCGCGG