Detailed information on CNT30455630


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30246246Saccharum spontaneumAvena sativa43.7128.6591.98212forward
CNT304538Saccharum spontaneumZea mays66.644.6791.64323forward
CNT30583728Saccharum spontaneumEchinochloa crusgalli28.4537.189.86138reverse complement

Expression of CNT30455630

Peptides detected in this lncRNA

>peptide 1 (47 aa)
QPHQPIAGRSVDGGGTGTGGRESGGRQDGPPRGRRRVRRVRDRPRMG*

>peptide 2 (88 aa)
SPTSPSQGAALMAAAPAPADAKAEAAKMDLLEDDDEFEEFEIDQEWDDKEEGNEAVQQWEDDWDDDDVNDDFSLQLRKELEGSNAQKS*

>peptide 3 (42 aa)
MGWYGCAALCVNGRKFTDISRQFDSTVPVPVEIIPVVVRTGL*

Sequence

>CNT30455630
CCAGCCCCACCAGCCCATCGCAGGGCGCAGCGTTGATGGCGGCGGCACCGGCACCGGCGGACGCGAAAGCGGAGGCCGCCAAGATGGACCTCCTCGAGGA
CGACGACGAGTTCGAAGAGTTCGAGATCGACCAAGAATGGGATGACAAAGAAGAAGGCAATGAAGCCGTCCAGCAGTGGGAGGATGATTGGGATGACGAT
GACGTGAATGATGATTTCTCGCTGCAGCTGAGGAAAGAGTTGGAGGGAAGCAACGCCCAGAAGAGCTGAAGTATTATTTCTCTAGTTTATAAATGATCTT
TATATGCCAGCTAGTTTCGGAACCGTGATGTGCTTTGGATGGGTTGGTATGGTTGTGCAGCTTTATGTGTGAACGGCAGAAAGTTTACGGACATCAGTCG
GCAATTTGACAGCACTGTACCTGTTCCGGTGGAAATAATCCCAGTTGTCGTTAGGACAGGTCTCTAGCGGAAACAGTAGAAACCC