Detailed information on CNT30454500


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673014Saccharum spontaneumSetaria viridis54.9735.9292.46199forward
CNT30520920Saccharum spontaneumSetaria italica54.9728.7292.46199forward
CNT30639966Saccharum spontaneumNymphaea colorata22.655.4686.5982forward
CNT30533721Saccharum spontaneumEucalyptus grandis33.4317.3481.82121forward
CNT30516978Saccharum spontaneumJuglans regia33.717.8983.61122forward
CNT30698134Saccharum spontaneumQuercus lobata38.47.4682.01139forward
CNT3021623Saccharum spontaneumCitrullus lanatus30.948.2585.71112forward
CNT30730016Saccharum spontaneumCorchorus capsularis26.814.6582.4797forward
CNT30629841Saccharum spontaneumVigna unguiculata33.1520.5181.67120forward
CNT30712288Saccharum spontaneumGlycine max40.0625.1382.07145forward
CNT3042792Saccharum spontaneumPrunus dulcis38.9538.2180.85141forward
CNT30182270Saccharum spontaneumSecale cereale45.8630.0787.95166forward
CNT30292897Saccharum spontaneumTriticum aestivum54.9733.7987.44199forward
CNT30222663Saccharum spontaneumHordeum vulgare38.427.4789.93139forward
CNT30390478Saccharum spontaneumTriticum turgidum54.9716.6987.44199forward
CNT30560479Saccharum spontaneumActinidia chinensis29.2810.0784.91106forward
CNT3084834Saccharum spontaneumVigna radiata22.9321.5684.3483forward
CNT30238125Saccharum spontaneumBrassica oleracea21.276.5784.4277forward
CNT30438727Saccharum spontaneumAegilops tauschii24.3127.8589.7788forward
CNT30249784Saccharum spontaneumAvena sativa48.6221.4488.07176forward
CNT3075006Saccharum spontaneumBrassica juncea34.5327.7880.8125forward
CNT30261201Saccharum spontaneumBrassica rapa34.5314.0880.8125forward
CNT30135064Saccharum spontaneumLolium perenne54.9734.8587.94199forward
CNT3014188Saccharum spontaneumZea mays59.1228.0192.52214forward
CNT30720963Saccharum spontaneumTriticum spelta54.9735.7387.44199forward
CNT30344813Saccharum spontaneumEragrostis tef54.9738.0590.95199forward
CNT30620323Saccharum spontaneumCajanus cajan38.127.7281.16138forward
CNT30483616Saccharum spontaneumChara braunii24.5922.2585.3989forward
CNT30570425Saccharum spontaneumVitis vinifera22.14.687.580forward
CNT30644515Saccharum spontaneumCannabis sativa36.7423.0181.2133forward
CNT3027985Saccharum spontaneumTheobroma cacao39.2326.1583.8142forward
CNT3037519Saccharum spontaneumCucumis melo23.488.2288.2485forward
CNT30104607Saccharum spontaneumOryza rufipogon29.8330.0891.67108forward
CNT30578384Saccharum spontaneumOryza barthii38.435.4692.09139forward
CNT30582394Saccharum spontaneumEchinochloa crusgalli48.3446.9294.86175forward
CNT30604850Saccharum spontaneumOryza punctata31.2211.6488.5113forward
CNT30557050Saccharum spontaneumPanicum hallii46.4144.2194.64168forward
CNT30551896Saccharum spontaneumOryza brachyantha47.2425.7990.64171forward
CNT30112090Saccharum spontaneumFicus carica32.875.8186.55119forward
CNT3040359Saccharum spontaneumMarchantia polymorpha30.9414.9583.93112forward

Expression of CNT30454500

Peptides detected in this lncRNA

>peptide 1 (58 aa)
FPVKFHDASRNYINLYTVLFTAEGKQGPHHLDTLARTHARMPTQRGAILCIFNNFYLK*

>peptide 2 (43 aa)
MPPKKNPPVNLDHPSAVCSLSASFFRPVSVSVGAVEGAPSLKDA

Sequence

>CNT30454500
TTCCCAGTAAAATTCCATGATGCATCCAGGAATTACATTAATTTATACACGGTGCTCTTCACTGCTGAAGGGAAACAAGGACCGCATCACCTAGATACCC
TTGCACGCACGCACGCACGCATGCCGACGCAGAGAGGAGCTATATTATGCATCTTTAATAATTTCTACTTGAAGTAGTAGGGGAGGTCGAGCACGTAGAG
GAGGAAGTATGCCCAGAGCACGCCGGAGATGCCACCGAAGAAGAACCCTCCGGTGAACTTGGACCACCCGTCGGCGGTCTGCAGCTTGTCGGCCTCCTTC
TTCCGCCCCGTGAGCGTGAGCGTGGGCGCCGTGGAGGGTGCCCCCTCGTTGAAGGATGCGAC