Detailed information on CNT30454075


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672312Saccharum spontaneumSetaria viridis52.03103.0488.63475forward
CNT30520284Saccharum spontaneumSetaria italica49.456.7386.47451forward
CNT30387274Saccharum spontaneumTriticum turgidum13.6927.998.4125forward
CNT30236263Saccharum spontaneumBrassica oleracea17.232.383.44157forward
CNT30436840Saccharum spontaneumAegilops tauschii20.5946.4286.17188forward
CNT30262014Saccharum spontaneumBrassica rapa14.1328.182.95129forward
CNT30131950Saccharum spontaneumLolium perenne17.9632.0392.68164forward
CNT3013737Saccharum spontaneumZea mays29.6858.1588.93271forward
CNT30328621Saccharum spontaneumAsparagus officinalis12.1637.2589.19111forward
CNT30556512Saccharum spontaneumPanicum hallii21.841.0391.96199forward

Expression of CNT30454075

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MKPRTTGSSISRLIEIIVNSRTRFDRWTGRSNGGLN*

>peptide 2 (38 aa)
HGASYISSVTSRCVQVNALIHHWFIYYKSPSPSCSSPN*

>peptide 3 (52 aa)
MAGLIKRMLRTCRRWWCRAGRSRSRRGTASSLGRARRCAGTRCSRSRAPRSR*

>peptide 4 (37 aa)
PWCILYILGHLEMCTSECINSSLVHILQITKSQLQLS*

Sequence

>CNT30454075
CCATGGTGCATCTTATATATCCTCGGTCACCTCGAGATGTGTACAAGTGAATGCATTAATTCATCACTGGTTCATATATTACAAATCACCAAGTCCCAGC
TGCAGCTCTCCTAATTAACGAGATCTCCATTAACAAAGGATCGATCTTGTCCCATACCCTCTCTCTCTCACTCATCACAAAATGAAACCACGCACGACGG
GTTCATCCATCTCCAGGCTCATAGAGATCATAGTTAATTCAAGAACACGTTTCGATCGATGGACAGGGCGGAGCAATGGCGGGCTTAATTAAGAGGATGC
TCCGAACGTGTCGAAGATGGTGGTGCCGAGCGGGTCGAAGTAGGAGCCGCCGGGGTACAGCCTCTTCTCTGGGTCGAGCTCGGCGTTGCGCTGGAACTCG
ATGTAGCCGATCACGAGCACCTCGATCCAGATGAGCGTCGAGATGGAGAACGGCAGCGGCTGGCCCAGGTAGGAGGACCCGTCCACCAGCTCCACCTGCA
CGCCATCGCATTCACAGGTTGGTTAGATCGTTCAAGCGCAGCGAGGATACACGAATCTGCATGTAAGCACTAGCTAGCTATTGACGTACCTTGCCGGCGT
CCTGCCAGGTGACGCCGGTGAGCCACTCGACGGAGAGGGCGCCGAGGGTGGCGAGCATGGCCCAGCGGCCGTGGATGAGCTCGCACTCGCGGAACCGCTG
GAGGCCGAACACCTCGCTGTAGGGCTGCAACGGGGTGGACTTGACGTCGGAGGACTCGAACCGGGTACTCCACGGGCTTCCCGAGCCCGAACGGGTCGAA
CCCGTAGTCGCCGACCAGCGAGCCGTCGAGGTAGTCGGGCGCCACGGCGCCGGGGAACCACAGCGGCCGGTCAGAGGAGGTCTTGGACACCTTCTTCGGG
GCAGCAGGCTTTT