Detailed information on CNT30453828


BLAST search results

BLAST vs Swiss-Prot:
sp|Q6Z4N6|40G2_ORYSJ, E-value = 2e-92

BLAST vs NONCODE:
NONZMAT000139, E-value = 2e-62

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30453828

Peptides detected in this lncRNA

>peptide 1 (60 aa)
MIEHVHDRSTRRWMMINERPFSSRAGSSSAGCRPRTTSRARCRCRRGRRRATCRRGGRRS*

>peptide 2 (59 aa)
MYSHKYMYRNFIITRYIHTYSCNVYMTTSSPLPRSCFIYAHMLTCMHKDGTRDEARLFC*

>peptide 3 (41 aa)
VEMDLFASKQGLRWTQRVELNTGAPKLTNNQLTPLQKLTIN*

>peptide 4 (30 aa)
MLLTMRTQRKPLPTSRLSVQSTDSSWYSGL*

Sequence

>CNT30453828
GTTGAGATGGATTTATTTGCATCCAAACAAGGCCTCAGGTGGACCCAAAGAGTTGAACTAAATACCGGCGCACCCAAGTTAACTAACAATCAATTAACTC
CCCTACAAAAACTGACAATCAATTAATCATAATAATAATAGGGATATACGTATGTTCTAATTATTAATACACTCGAGCAACTTTATTATGTATGTACTCC
CATAAGTATATGTATCGCAACTTTATTATTACAAGGTACATACATACATACAGCTGCAACGTATACATGACCACGAGTAGCCCTTTGCCTCGCTCCTGCT
TTATCTATGCACACATGCTGACATGCATGCATAAAGACGGCACAAGAGACGAGGCTCGGTTATTCTGCTAGTACGTATATGTATGCGTACATAGATACAT
ACATAGACCAGTGTGTACTGGTATAAGTGCATGCACGCACGTCTCCTCCATGCATGATCGAGCATGTGCACGATCGATCGACGCGACGATGGATGATGAT
CAACGAGCGTCCGTTCAGTAGTAGGGCTGGATCTTCCAGCGCTGGTTGTCGCCCTCGCACCACTTCCAGAGCACGATGTCGGTGCCGTCGCGGACGCCGC
CGTGCCACTTGTCGCCGTGGAGGGCGTCGAAGTTGAGGTAGATGTTGTTGACCATGCGGACGCAGCGGAAGCCGTTGCCGACGTCGCGGCTCTCCGTCCA
GAGCACCGACTCGTCCTGGTACTCCGGGTTGTAGGGCACCAGCTTCACGGGGTGGCCCTGCCCCGTGGAGTGCTTGAGCGCCTCGCCGGTGACCTTGTTC
ACCAGCGCGAAGGCCGGGTACCCTTCCTCGTCCCGCACCCGGGTGCTGTGCCGCATGTCCTTGATCCAGTGCTGGTACTCGTCCCGCGGGTTGGTGGGCG
CCAGGCACGCCGTCCCGTTGCGCACCGTCAGGCTGTAG