Detailed information on CNT30453579


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9S7M0|CB3_ARATH, E-value = 5e-126

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30369948Saccharum spontaneumOryza glumipatula65.9552.1586.18521forward
CNT30116796Saccharum spontaneumOryza nivara66.7156.9784.06527forward
CNT30556505Saccharum spontaneumPanicum hallii63.6771.9696.82503forward

Expression of CNT30453579

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MQPSAPSIAHRPWITSSALFRANASGSADSPAVSQP*

>peptide 2 (63 aa)
MAWTKKPNMENMARRPFLISLTLSSAKVTGPLMRKPSTRPMRMTWNPSTARMLCACTRLGLPR*

Sequence

>CNT30453579
AAGAAAAATAGTAGACACAACTACATATATGGACACATCACACACCGAATCAGTTAACAACTAAAACGGAGCAGATGGAATTGAAGACCAAAACTAGTCC
AGTACGTTTCTGAGTTCTGAGAGAGCACAAGGATATTTGCATTCGTTCATGGTACAAATGTAATGTCACAACACAAACGAGTAGTCTACAATGTCCCGGC
ACGCCGCCGTGTCCGGCTAGCTTAAGACCCTGGCGCGAACTTGGTGGCGTAGACCCAGGCGTTGTTGGCGACGGGGTCGTCGAGGTGGTCGAGCAGGTTC
TCGAGGGGCCCCTTGCCGGTGACGATGGCCTGGACGAAGAAGCCGAACATGGAGAACATGGCGAGGCGGCCGTTCTTGATCTCCTTGACCTTGAGCTCGG
CGAAGGTGACGGGGCCGTTGATGCGGAAGCCCTCGACGAGGCCCATGAGGATGACCTGGAACCCCAGCACGGCGAGGATGCTCTGCGCGTGCACCAGGTT
GGGGTTGCCGAGGTAGTCCAGCCCGCCCTCGGAGAAGATCTGCGCGCCGGCCTTGAACCACACGGGCTCCTTGAAGTCCACGCGCACCCACTTCTCGAGC
ACCTCCGGGGTGATGCAGCCCAGCGCCCCCAGCATCGCCCACCGCCCGTGGATCACCTCCAGCGCCCTGTTCCGCGCGAACGCCTCCGGGTCCGCCGACA
GCCCGGCGGTGTCCCAGCCGTAGTCGCCGGGGAACTCGCCGGTGAGGTAGGACGGCGTCTGCGCGGAGAAGGGGCCCAGGTACTTGACGC