Detailed information on CNT30453464


BLAST search results

BLAST vs Swiss-Prot:
sp|P0C1M0|ATPG_MAIZE, E-value = 3e-131

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30453464

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MERVLASSMALSVALLMALIRAASSLASDSCRARRIWLLR*

>peptide 2 (30 aa)
IEEVLDAAILFQFRVGTGQLKCQMEVKHRN*

>peptide 3 (30 aa)
MSRGTQNSVAFVLSGITGRVDKKKMRKNYI*

>peptide 4 (53 aa)
DRGSARCSNSISVSSGHRTTEVSNGGKASKLAGHLQDKARFKILRLYILASLD*

Sequence

>CNT30453464
GATAGAGGAAGTGCTAGATGCAGCAATTCTATTTCAGTTTCGAGTGGGCACAGGACAACTGAAGTGTCAAATGGAGGTAAAGCATCGAAACTAGCTGGAC
ATTTGCAAGACAAGGCGAGATTTAAAATACTCAGATTATACATTTTGGCATCTCTGGATTGAAATTCTTGTGTATGTCGCGAGGAACACAGAACTCCGTT
GCGTTTGTGCTATCAGGAATTACAGGCAGAGTGGACAAGAAGAAAATGAGAAAGAATTATATATAGCAGGAGCACCGCACCAAGAAGGCCACCACAGGGC
ACAGCTCGGCTCACACAAATCACAAGGTCTCAGGAATTACAGGCAGAGTGGACAAGAAGAAAATGAGAAAGAATTATATATAGCAGGAGCACCGCACCAA
GAAGGCCACCACAGGGCACAGCTCGGCTCACACAAATCACAAGGTCTCAGGCTCAGACGAGGGCTTCGGCACCGGCGACGATCTCGAGGATCTCACCGGT
GATCTTGGCCTGGCGCTGTCGGTTGTAGGAGATGGAGAGGGTCTTGGCGAGCTCGATGGCGTTGTCGGTGGCGCTGCTCATGGCGCTCATCCGGGCGGCG
AGCTCGCTGGCGAGCGATTCCTGCAGGGCACGGAGAATCTGGCTGTTGAGGTAGAGCGGGAGCAACGCGTCAAGGATCTGCACGGGGTCCTGCTCGAACT
GCACCACGGGGGAGAAGGGCTGCGTCTCGATCTTCACCTTCTCGCGCTCCACGGTGAGCTTGCCCTCCTTGGTGGTGAGGCGGAAGAGCTCGTCCTCGGT
GGCGTCCACGCAGACGCCGTTGATGTCGCAGATCTCGCCCTTGGGGGACATGGGGAGCAGCGTCTGGATGATGGGGTCGGAGCGCACCAGCGAAACGAAC
TTGGAGTAGAGCAGCTCCACCTTGTCCACCTCCTCCGAGACGAAGAGCGAGTAGACGAGGTCGCAGATGGCCTGCGAATCCTTGACGGTGGGCACGCCGT
TCACCTCCAGGTCCCGCTCCAGCGGGATGTAGGGGCGGCGCTGGAAGTAGGCGTTGCCCTTCTTCCCCACGCTGATGACGCTGTACTGGAGGCCCAGCTG
CTTGAACTCCTCGATGCGGGTCTCCGCCT