Detailed information on CNT30453185


BLAST search results

BLAST vs Swiss-Prot:
sp|P84977|GRP3_POPEU, E-value = 2e-10

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30453185

Peptides detected in this lncRNA

>peptide 1 (79 aa)
MLRPSSSLPFMPSMALRIASSVEKVTKPKPRPPPPPPERGPPRDWASLTVMLRPSSSLPFMPSMALRIASSVEKVTKPKP

>peptide 2 (51 aa)
MHGAEDEDEHSTNNNIEGASLRSKTQMGNNNKHEHTDTTTTTNNKINPALD*

Sequence

>CNT30453185
TTTCAGAAGAGAACAATCATTTGCAGCACCAAGAAGCACCTTTTTTTCATTGATTGACTGATGATTAACAACTTGCCATCGATCCCAGGCCCAGCTCATG
CTGATTGATGCACGGGGCCGAAGACGAGGACGAACACAGCACTAACAACAACATCGAAGGAGCGAGCTTGCGATCAAAAACACAGATGGGCAACAACAAC
AAACACGAACACACAGACACGACGACAACGACGAACAACAAGATAAACCCCGCTCTGGACTAGGGTAACACAGCAACACGGTAGCAGTAGCGAACAAGAT
AACTTGGCCGCGCGGGCCCCACCGCTCAGTTCCTCCAGTTCCCCTCGGAGTTGCCGTACCCGCCGCCGCGGCTGCCACCGCCGTAGCCGCCACCGCCGCC
GCCGTAGCCGCCACCGCCGCCGCTGCGGCCACCGTAGCCACCGCCGCCGTAGCCGCCGCCGCCACCGCCGTAGCCACCTCCATCACGGCGGCCGTAGCCG
CCACCGCCTCCACGGCCGCCGCCGTAGCCGCCGCCACCCCCGCCGGAGCGCGGGCCGCCGCGGGACTGGGCCTCGTTGACGGTGATGTTGCGGCCGTCGA
GCTCCTTGCCGTTCATGCCCTCGATGGCGCTCCGCATCGCCTCCTCCGTCGAGAAGGTGACGAAGCCGAAGCCGCGGCCGCCGCCACCCCCGCCGGAGCG
CGGGCCGCCGCGGGACTGGGCCTCGTTGACGGTGATGTTGCGGCCGTCGAGCTCCTTGCCGTTCATGCCCTCGATGGCGCTCCGCATCGCCTCCTCCGTC
GAGAAGGTGACGAAGCCGAAGCCGCG