Detailed information on CNT30450881


BLAST search results

BLAST vs Swiss-Prot:
sp|A8MRC7|B3GT2_ARATH, E-value = 4e-11

BLAST vs NONCODE:
NONZMAT003838, E-value = 4e-18

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520592Saccharum spontaneumSetaria italica41.2572.1485.94448forward
CNT30394727Saccharum spontaneumTriticum turgidum65.4731.5383.4711forward
CNT30554834Saccharum spontaneumOryza glaberrima53.6819.1182.85583forward
CNT304455Saccharum spontaneumZea mays20.5377.793.72223forward
CNT30117540Saccharum spontaneumOryza nivara44.5783.8887.19484forward

Expression of CNT30450881

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MFSAQSNTTMSPWRRASTATSAASTGSVTLQKTKRTSTRATDAGGCSA*

>peptide 2 (82 aa)
MPAVTLKYLKVAAQRRLSLSMCTAMVSGRKLSMNQLRSYRFLPLPPMLSHFPTSRSSGPCVSLWRRMSWLVDTQRATSQDTT*

>peptide 3 (34 aa)
GLRTPPWYNQPTSVTGNKKKIELINWSITAGGTG*

>peptide 4 (46 aa)
MSRRSRRLGMVSTPTSRLSSGCGDGVSASAATEAFFFSSAPVSATE*

Sequence

>CNT30450881
GGCTTACGCACGCCACCTTGGTACAATCAGCCAACGTCAGTCACAGGAAATAAAAAAAAAATTGAACTGATTAACTGGTCGATCACGGCAGGTGGGACAG
GTTGATGCCGGCGGTGACGTTGAAGTACTTGAAGGTCGCCGCCCAACGGCGGTTGTCCTTGAGCATGTGCACGGCGATGGTGTCCGGCCGGAAGTTGTCC
ATGAACCAGTTGAGGTCGTACCGGTTCTTGCCCCTGCCGCCGATGTTGAGCCATTTCCCGACGAGCAGGTCCTCGGGCCCGTGCGTGTCGTTGTGGCGGA
GGATGTCCTGGTTGGTGGACACCCAGCGCGCGACGTCCCAGGACACGACGTAGCCCATGCCGTGCATGAACGGCATGGGGTCGTCGCCGACGGGGAAGCC
GTAGCCCAGGTAGACGTCGTGGCGGGGCTTGGAGCGGAGCTCCTCCACGAGCGGCGCCACGCGCAGGTACGTGTCGTCGTCGGTCTTCATCACGTAGTCG
TAGGGCGACGACGCGAAGACGCGCGGCACGGAGGAGAGGTACGCGTGCGTCTTGCCGTCGTTCATGTTCTCGGCGCAGTCCAACACGACGATGTCGCCGT
GGCGCCGGGCCTCCACCGCCACCAGCGCGGCGTCGACCGGGTCGGTCACGTTGCAGAAGACGAAGCGGACGTCCACGCGCGCCACGGACGCGGGCGGCTG
CAGCGCGTAGGCCATCCGCACGATGTCCCGCCGCTCCCGCCGGCTCGGCATGGTCAGCACGCCCACGAGCAGGCTGAGCTCCGGCTGCGGCGACGGCGTC
TCGGCGTCGGCGGCGACGGAGGCCTTCTTCTTCTCGTCGGCGCCCGTCAGCGCGACGGAGTAGTAGCCGCCGGCGCCGTCGTCGGTGCCCGCAACGCCGC
GGCAGAGCACGCCGAGGCCCTGGGAGCGGGCGTGCGAGGAGCCGAGGCTCGGGAGCGCCAGCAGCAGGGCCAGGAGGCCGAGCGGCACCAGGAGGAGGTA
CGGCGTGCAGAGCGACGCCGTGTGGAGGTGCAGCCCGTGCGACGAAGTGGTCTTCATGGCGCACACAAGCTAGCGTTTCGTTCCGT