Detailed information on CNT30450846


BLAST search results

BLAST vs Swiss-Prot:
sp|P80728|MAVI_CUCPE, E-value = 2e-16

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520668Saccharum spontaneumSetaria italica19.3948.0392.54134forward
CNT30362559Saccharum spontaneumSorghum bicolor12.8832.3685.3989forward
CNT30147627Saccharum spontaneumBrachypodium distachyon9.9922.9289.8669forward

Expression of CNT30450846

Peptides detected in this lncRNA

>peptide 1 (75 aa)
MPARPQPERAGTRRRSWRRGPSARRWGAATARPWRRRRAWSRRGSGTVRRWGTRKGQQRRRRRGCPPSGRRRSGP*

>peptide 2 (42 aa)
VFSENLFIHNSFENSLIQTSPKLSMGQKICLGECLLPRRKMK*

Sequence

>CNT30450846
GTATTTTCTGAGAATTTATTCATTCATAATTCTTTTGAGAATTCTTTGATCCAAACAAGCCCTAAGCTCTCAATGGGTCAGAAAATCTGCCTTGGCGAAT
GCCTCCTACCTAGAAGAAAAATGAAATAGAAGGACGTAAAGCACACCGAATTTCAGACGAATATATAAACAGCCCAAACATGAGGAAATTAATTGACAAC
CGGCAGAAATCCCAGGATCCACAGAATCAGAGCAGTGCATGAAACCAGACGGGCAAAAAAAAGATATAACAAACACAGATCCAGGCGCCGTCCCCTAGCC
GACACTAAACGACCCTGATCATGCCAGCACGGCCGCAGCCAGAGAGAGCAGGGACGCGGCGACGGAGCTGGCGGAGAGGGCCTTCGGCGCGGCGTTGGGG
TGCGGCGACGGCGCGGCCGTGGCGCCGCCGGAGGGCTTGGAGCCGGAGGGGGTCGGGGACGGTGCGGCGGTGGGGGACCCGGAAGGGGCAGCAGAGGAGG
AGGCGACGCGGATGTCCACCTTCTGGCCGGCGGCGCAGTGGCCCGTGAAGCCGCAGAGGAAGTAGTGGTGGCCCGTGGTGTTGAGGACGACGGAGTCGTT
GCCCGTGGACCAGGTGGCCGTCGGCTTGCTGGCGTCGCAGTTCTTGTAGTCCGCCTTGCTCACCGCCAGCACGTCGTGGAACTGCTTGTTG