Detailed information on CNT30450830


BLAST search results

BLAST vs Swiss-Prot:
sp|Q76H85|H4_SILLA, E-value = 8e-51

BLAST vs NONCODE:
NONGMAT001327, E-value = 3e-52

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30546681Saccharum spontaneumIpomoea triloba28.8650.8584.1239forward
CNT30221015Saccharum spontaneumHordeum vulgare29.5946.4996.73245forward
CNT30386576Saccharum spontaneumTriticum turgidum37.5653.0796.46311forward
CNT30437818Saccharum spontaneumAegilops tauschii37.4453.6396.77310forward
CNT30211318Saccharum spontaneumHelianthus annuus11.8425.1982.6598forward
CNT30619612Saccharum spontaneumCajanus cajan19.3238.1980.62160forward
CNT30357929Saccharum spontaneumLactuca sativa33.5762.0580.58278forward
CNT30645456Saccharum spontaneumCannabis sativa28.3830.6484.68235forward

Expression of CNT30450830

Peptides detected in this lncRNA

>peptide 1 (79 aa)
MSPEMRFTPPLRASLRIAGLVMPWMLSRSTFRWRFAPPLPSPLPPLPRPDIVAGRRCLLFHALVVSKGIGEFFWGGAWTW

Sequence

>CNT30450830
GCACGACTGCTCTGCTATAATTCAGCACTTTCCACATAATTGTAAGGGTCAGATTACAAACAATGCAAGTCGTAACTGACGAAACAAGTGCACTGGGCAA
TCAGACAAACTACTCCTGACCTTGGAAAACTGAAAAGTACACGAACTGGATGACAGATTGGGCTTAATATCCACTCAAAACTGCAAGAAAAAAGAATTTC
TTCACGAATTTGATGGATCTAATTCGCGAGAAAGTGGCACCAGATTGACGGCCAAAGGTTGACCAGGAATCACTTCAATTCTCGAACGATAAGATTGGAT
TACATCAGAAGCGCAACTGCAACAGTACTACCACCACAGTTCCAGCCACAGGCAGAGAAATAAAAAACGTAACCCTAACGACACACGGCATCCACGACAG
AAAGGAGGAAAGGCGCCCAACCCATCCTTAGCCTCCGAAGCCGTAGAGGGTGCGGCCCTGGCGCTTGAGCGCGTAGACGACGTCCATGGCGGTGACGGTC
TTGCGGCGCGCGTGCTCGGTGTAGGTGACGGCGTCGCGGATGACGTTCTCGAGGAAGATCTTGAGCACGCCGCGGGTCTCCTCGTAGATGAGCCCCGAGA
TGCGCTTCACGCCGCCCCTCCGGGCCAGCCTCCGGATCGCCGGCTTGGTGATGCCCTGGATGTTGTCGCGGAGCACCTTCCGGTGGCGCTTCGCTCCGCC
CTTACCCAGCCCCTTGCCGCCCTTGCCGCGCCCCGACATCGTCGCCGGCCGCCGGTGCCTTCTCTTTCACGCGCTCGTCGTCTCGAAAGGAATTGGGGAA
TTTTTTTGGGGAGGTGCTTGGACTTGGG