Detailed information on CNT30450215


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671891Saccharum spontaneumSetaria viridis3.9721.294.3453forward
CNT30227885Saccharum spontaneumAnanas comosus9.1536.0986.07122forward
CNT30362959Saccharum spontaneumSorghum bicolor12.8971.6796.51172forward
CNT30153003Saccharum spontaneumPrunus persica8.754.2183.62116forward

Expression of CNT30450215

Peptides detected in this lncRNA

>peptide 1 (42 aa)
VSNVNRQSTSVHLLKLYSNRDQVISYTRTFRDQLICYSTSKK*

>peptide 2 (34 aa)
MKSQNMQWLEKVQNLCTNITGHDLHCADMQGMSA*

>peptide 3 (29 aa)
MTDCTEQEMHTRNTTLYQSFTGFNTICNT*

>peptide 4 (31 aa)
MLFHLKEIKETRNHKLHGINNCKQPRVSWNG*

Sequence

>CNT30450215
AGTGAGTAATGTAAATAGACAGTCTACATCCGTACATTTACTAAAGCTATACTCAAATAGGGATCAAGTGATTAGCTATACCAGGACATTTAGGGATCAA
TTGATATGCTATTCCACCTCAAAGAAATAAAAGAAACAAGGAATCACAAACTTCATGGAATAAACAATTGTAAACAACCAAGAGTTAGTTGGAACGGTTA
GGTAGCTTGAAATCATGCAAGCAACATTTAGCTTACACACTGAAATTATCTTCACCAACCAAAAAGCGAGCATCAAAACATGAATGAAGTCACAAAATAT
GCAGTGGCTGGAAAAAGTACAAAATTTGTGTACGAATATAACAGGGCATGATTTGCACTGTGCAGACATGCAAGGAATGAGTGCATAATTCAATATAAAT
GACAGATTGCACAGAACAAGAAATGCACACAAGAAACACAACTCTGTATCAGTCATTTACTGGTTTCAACACCATCTGTAATACGTAGTGTTATGGTAAG
CAATAAATAATAACAACTGCAAGAGTGCAGCACTGGGCAGAGCCAGCCCTGTTCCATGCTTTCACTGGACAGCAATTATTTTCTGTGATTTCCATTACAA
ATTGATGTTGATATGTGAAGGTGAGGCATAGTGTAGTAGAGATGCAAGCAATGGAACTTTGTGCTGAATCTGCCACTGTGCAACAGTGACCCAATAGCAA
TGCCACCTTGTTACGAATTCTATGTAACAAACCATTTCAAATCAACAGTTCAAATTTCCTAGAACAGAAGACTAATATAGGTGGATAGCTACACTAGGTA
ACTTGAGAGTTAGAAATCTGAATATAGTACCAAGGGTACAAATCTGGACCAGACCACAAGATGCACAGATTACCTAACTGCCAACGCAGAATAGATCAAC
AAAGGCAGCAATAAGTAAACAATACAGAATTAGACAAAGATCTAAACCGGGGTATACCTTGACGAAGTTACCGAGTGTCTTGGTGGAGCCACGGGACGAG
CTGCTCCACGATCTGGTGCTCCTTGACGGGGAGCGAGTGCAGGTAGATCTCCTCGATCTTGTTGATCCGGCCCTCCTTCACGAGGCGCCCGAGCTTGGTG
ACGGGCACCCACTTCTCCTCCTCCTGCTGGCGGCCGCCGCGCCGGCCGCCACGGCGCCCGCCACGGTCGCCGCGACCGCCGCGACCGAACCCGCGGCCGA
AACCGCCTCGGTCGCCGCCGCGCTCGCCGCCACGCTCGCCTCCGCGGTCCGCCATAGCTGGGTGAGTTGGGGGGGTCGGGGTTGCGTCCGGTGTGGAGCG
ATGGGAGCGGTGTGCTGCGTAGCGGCGGCGGCGG