Detailed information on CNT30450039


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9SX78|CXE2_ARATH, E-value = 4e-71

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30187028Saccharum spontaneumSecale cereale44.5940.4388.96634forward

Expression of CNT30450039

Peptides detected in this lncRNA

>peptide 1 (76 aa)
MVTSREVTPVSASEDAATTSVPISRFTRPFLYSMRNGEKSNFTCELGSPARRACSSCRLAAAPVEQCEPRRRKSSTS

>peptide 2 (54 aa)
MLPPALSPARNRRDRSPYWDSHGSDPAFAFASTHLSSAHESSYAAGSGCSGARR*

>peptide 3 (40 aa)
MPGCARCCRPRCRRRGTGGTGRRTGTATGPTRRSRSRAPT*

>peptide 4 (35 aa)
EEITTIHSTSTQKLHDAVGSRVTLLYYYYSTLGLL*

>peptide 5 (33 aa)
MTRNARKQTHRSPSPFHTDGVAGEEPFFSSDAQ*

Sequence

>CNT30450039
CCGAGGAAATCACCACCATACATAGCACTAGCACACAAAAATTACACGATGCAGTAGGTAGTAGAGTGACGCTTCTATACTACTATTATAGTACTCTGGG
ACTACTGTAACTGGCGGTAACCGCTACACGCAGCGCGTAGATACAGCTGCGTCAGCACAGTGCACGGCACGCTAGCCTGTGCCCTGTAGACTGCAGTCAA
TGACACGCAACGCGCGCAAACAAACACACCGGTCCCCCTCTCCATTCCATACAGACGGGGTTGCTGGGGAGGAACCGTTCTTCTCTTCCGACGCACAGTA
ATCACCAAGGACAAAAAAGTAATTACTACTACTACCACTCGCTACTTACTATAGGTATACTGATGATGTTGTCGCGTTACCGCAGACTGCAGTTACTGGT
TGCCGCGGCGGCAGGTAGGAGTACTCCGGTTGCTAGTCGCGGTTAATGAAGGCGACGAGCTTGGCCATCTCGGCGAGCGCCTGCGGCGAGCCGAGCTTGG
TGAGGAAGTAGACGTGGCCCTCGCCGGGGGTCTCGTACAGCTCGGCCTCCCCGGGCCAGGCGGTCCTGCCCGGACACGGTGACCAGCACGCGGGAGGCGC
CGAGGTGCTGCCACGAGGACGCCGGCAGGACGAGCGGGTCCGCGTAGGGGTGGTTGATCGGGTACCTCCCCGCGCAGATGAAGTTCCAGGTGCGCGCCGC
GGACTGGAGGTACGCCGGGTCCGTGGAGTCGGCGCCCACGGGGCTCCGGCCCTGGAAGTAAGGGTCCAGCAGCGCCACGCCCTTGATCCGCGCGCCGCCG
TCCAGGCCTTCCTCCCCCGCGCGCAATGCCAGGTTGTGCGCGATGTTGCCGCCCGCGCTGTCGCCGGCGAGGAACAGGCGGGACAGGTCGCCGTACTGGG
ACAGCCACGGGTCCGACCCGGCGTTCGCGTTCGCGAGCACCCACTTGAGCTCCGCCCACGAGTCGTCGTACGCCGCCGGGAGCGGGTGCTCGGGCGCCAG
GCGGTAGTTCACCGACACGGCCACGACGCCCGCCCTGGCGGCGAGCGTGTTGAGGTAGGCGTGGTAGATGGGCGTGAACGCGGACTCCACCACGAACGCG
CCGCCGTGGAAGTAGACCAGCACGGGCACCCCGGTGTTGGCGCGGAAGCTCGGGAGGTAGAGCCGCGCCGCGACGCCCGTGGACGGGTCGATGGTGACGT
CGCGGGAGGTGACGCCCGTGAGCGCGTCCGAGGACGCGGCCACCACGTCGGTGCCCATCAGCCGCTTCACGCGCCCGTTCTTGTACTCGATGAGGAATGG
GGAGAAGTCGAACTTCACCTGCGAGCTCGGGTCCCCGGCTCGCCGCGCCTGCAGCAGCTGCCGCCTCGCCGCCGCCCCGGTAGAGCAATGCGAACCCAGG
AGGAGGAAGAGCAGCACCAGCG