Detailed information on CNT30449969


BLAST search results

BLAST vs Swiss-Prot:
sp|Q41803|EF1A_MAIZE, E-value = 0.0

BLAST vs NONCODE:
NONBNAT001751, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30639730Saccharum spontaneumNymphaea colorata46.9964.5384.15593forward
CNT30371709Saccharum spontaneumArabidopsis thaliana49.1396.2787.26620forward
CNT30274113Saccharum spontaneumChenopodium quinoa36.9374.6886.27466forward
CNT30727585Saccharum spontaneumCorchorus capsularis61.0957.286.77771forward
CNT30629525Saccharum spontaneumVigna unguiculata30.5989.7786.01386forward
CNT30224132Saccharum spontaneumHordeum vulgare34.0762.6888.37430forward
CNT30564256Saccharum spontaneumActinidia chinensis48.6552.7587.13614forward
CNT30146334Saccharum spontaneumMedicago truncatula49.3762.6886.2623forward
CNT30440472Saccharum spontaneumAegilops tauschii26.2355.6390.63331forward
CNT3059458Saccharum spontaneumArabidopsis lyrata74.647585.77942forward
CNT3074067Saccharum spontaneumBrassica juncea74.6492.7284.82942forward
CNT30608730Saccharum spontaneumGossypium raimondii35.667585.11450forward
CNT30480841Saccharum spontaneumArabidopsis halleri31.4663.9386.65397forward
CNT30151899Saccharum spontaneumPrunus persica26.5530.3785.97335forward
CNT3052982Saccharum spontaneumAmborella trichopoda27.126.1585.09342forward
CNT3024428Saccharum spontaneumPopulus trichocarpa49.682.0485.46626forward
CNT30148140Saccharum spontaneumBrachypodium distachyon29.497.6390.03371forward
CNT30594462Saccharum spontaneumEragrostis curvula75.2881.6291.26950forward
CNT30113122Saccharum spontaneumFicus carica39.0659.486493forward

Expression of CNT30449969

Peptides detected in this lncRNA

>peptide 1 (45 aa)
MFDIKITEMSLNSTLVLTKIKVLNRPDRHCQHSLVAHAITAITSH*

>peptide 2 (47 aa)
MLSPSKPEMGTKWILSGLVDLSIMLSPSKPEMGTKWILSGLYPTFFR*

>peptide 3 (96 aa)
MMMTWEVKLAASLAGSSLELEATYPRFRSFTATFLTLKPTLSPGRASWRASWCISTDLTSVVRPLGPKVTTIPGLMTPVSTRPTGTVPIPPILYTS*

>peptide 4 (81 aa)
MTPTATVCLMSRTAKRPRGGYSEKVSTTMGLVGTIFTIPASPFLRNLGSFSSSLPDRLSILVTSSANLTAMCEVWQSSTGA*

>peptide 5 (54 aa)
MVHLNRLNLSSKATGTEGNHHTGLDDTSLNTPNRNSSNTTNLVHILKGETQGLV*

>peptide 6 (50 aa)
CNRNLNTARQVRYGRANHQLFNNSKIGKQAITATRVVTKLITMAHTLCSI*

Sequence

>CNT30449969
GTGCAACAGAAATTTAAACACTGCTAGACAGGTAAGGTATGGACGAGCGAATCATCAGCTATTTAATAACAGCAAAATAGGTAAACAGGCGATCACTGCA
ACAAGGGTAGTAACAAAACTCATAACCATGGCTCATACCCTATGTTCGATATAAAAATAACAGAAATGAGTCTTAATAGCACCCTGGTTTTAACGAAAAT
AAAAGTTCTAAATCGACCAGACAGACATTGCCAACACAGTTTAGTTGCTCACGCAATAACAGCAATAACCTCCCACTAGGTATCCCCAAGCAAACACAGA
ACCAGCCAGACACCTCATTTCTTCTTGGCGGCAGCCTTGGTCACCTTGGCTCCAGTTGGGTCCTTCTTCTCCACACTCTTGATGACTCCAACAGCCACCG
TTTGCCTCATGTCCCGCACAGCAAAGCGACCAAGAGGAGGATATTCAGAGAAGGTCTCCACCACCATGGGCTTAGTGGGAACCATCTTCACCATACCAGC
ATCACCGTTCTTAAGGAATTTGGGCTCCTTCTCAAGCTCCTTGCCAGACCGCCTATCAATCTTGGTAACGAGCTCAGCAAACTTGACAGCAATGTGTGAG
GTGTGGCAGTCCAGCACTGGCGCGTAGCCGTTGCCGATCTGCCCAGGGTGGTTCATGATGATGACCTGGGAGGTGAAGCTAGCAGCCTCCTTGGCAGGGT
CATCCTTGGAGTTGGAGGCCACATACCCACGCTTCAGATCCTTCACAGCAACATTCTTAACGTTGAAGCCAACGTTGTCACCAGGAAGAGCCTCCTGGAG
AGCCTCATGGTGCATCTCAACAGACTTAACCTCAGTAGTAAGGCCACTGGGACCGAAGGTAACCACCATACCGGGCTTGATGACACCAGTCTCAACACGC
CCAACAGGAACAGTTCCAATACCACCAATCTTGTACACATCCTGAAGGGGGAGACGCAGGGGCTTGTCTGAAGGCCTCTTTGGCTCATTGATCAAGTCCA
GAGCCTCAAGCAGGGTGGGGCCCTTGTACCAGTCAAGGTTGGTGGACCTCTCAATCATGTTGTCACCTTCGAAACCAGAGATGGGAACAAAGTGGATCTT
GTCAGGGTTGGTGGACCTCTCAATCATGTTGTCACCTTCGAAACCAGAGATGGGAACAAAGTGGATCTTGTCAGGGTTGTATCCAACCTTCTTCAGGTAG
GAAGAGACTTCCTTCACAATCTCATCATAACGGGCCTTCGAGTACTTGGGTGTGGTGGCATC