Detailed information on CNT30448224


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522239Saccharum spontaneumSetaria italica82.2442.8787.26565forward
CNT30248408Saccharum spontaneumAvena sativa20.0911.6986.23138forward

Expression of CNT30448224

Peptides detected in this lncRNA

>peptide 1 (47 aa)
ISRKHKPWLCWNAPSLQKHVPFWRECLPRRQEMAVALKLLLMMIHLA*

>peptide 2 (55 aa)
MMVSRPASTRSRGKGIRKSDVDKAAEGESCAFFEARMRRNISPVSTSPAWFSSVP*

>peptide 3 (36 aa)
SVESTSPGSAGMLPPCRSMCLSGGNVCLEDRKWLWL*

>peptide 4 (30 aa)
MGCANYMESSEFGYYLFYVRRRKSGLKNDG*

Sequence

>CNT30448224
ATCAGTCGAAAGCACAAGCCCTGGCTCTGCTGGAATGCTCCCTCCTTGCAGAAGCATGTGCCTTTCTGGAGGGAATGTCTGCCTAGAAGACAGGAAATGG
CTGTGGCTCTGAAGCTGTTGTTGATGATGATACATCTGGCATGAAGACATTGCAGGCTTAAAGTTTATCGGCCCTTTGTTTTTTGGTGAACTAAGGGTTC
TTTGTCACACAATGGCGTTATATTCCTTGGGGAATGCTCTAAGAAACTATGACTACTCATGCCAACATGTTATGCAGAGTCTGGTTTTATAAGGAAGGCA
AGTGAGGAGAGAATTTCGAATCGTTAGAACAAACACTCAAGCCTGGTCCAATCTTGGCGGCAACTGAAAAGAGGGAAACGGAAAGTGGATAGACGAATCT
GATGGGCTGTGCAAACTATATGGAGTCCTCTGAGTTTGGCTACTATTTGTTCTACGTAAGGCGCAGAAAGTCTGGGCTTAAAAATGATGGTTAGCAGGCC
GGCGAGCACGCGATCCCGCGGGAAGGGAATAAGGAAAAGCGATGTTGACAAAGCTGCTGAAGGGGAATCCTGCGCTTTTTTCGAAGCAAGGATGAGAAGG
AATATATCGCCTGTGTCGACCTCGCCTGCTTGGTTCTCTTCTGTTCCGTGACTTGGTTGTGCTCCGCTGGATCGTGCTCGTGCCAGC