Detailed information on CNT30448019


BLAST search results

BLAST vs Swiss-Prot:
sp|Q10RZ1|BAMY2_ORYSJ, E-value = 3e-152

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522465Saccharum spontaneumSetaria italica28.7340.4892.76387forward
CNT30186723Saccharum spontaneumSecale cereale19.0831.1985.21257forward
CNT30392070Saccharum spontaneumTriticum turgidum15.5921.8185.71210forward
CNT30575667Saccharum spontaneumOryza barthii16.4879.2988.74222forward

Expression of CNT30448019

Peptides detected in this lncRNA

>peptide 1 (49 aa)
MRLTNAAKRRQLSGWKRSGPMRRYVNATMRSSAALSAAVATTWSCAVSS*

>peptide 2 (39 aa)
MRSPCSRSICEYQLMKNCPYSVLHLPSRRKKPVSSGQSL*

Sequence

>CNT30448019
CCGCACCTTCTGATCTCTGAAGCACGAACAACAATGGCGGCCTAACGGCCCAAGCTGGTATGTTTTCACAAGTCTGTTTCTTTGTTCAAATTATAGCAGT
ACAAATCATGAGTTTATCCACACATTCTGTAGGTGTAGGATAGTAACACAGCAGCAGAACATCAAACCCATCTCCTGCCAAGCTTTGAGCAGCGCCAAAG
CCTCGAACGTGACACCTACGTACCGTAACCGTACCCAATCACCCACCCACCTACTACCTCGCTTGCAGCTTCCGTTCACCCCTTTTACGTACACTATTGC
GCGGTGCACGCATTCCGCCGATCGACCACACGGCAGCCGGCCGGCCGGCCGGCGCAGCTTATAAGTATTGACGACCTGAGGTAGTAGTAGTAGTAGCGTA
CGTATCACCGTCTAGTGGAACACGGACAACGGGTGGGAGCGCCGGCCACCTTCACGGTCGGCGGCGGCTTAGTTGGTGAGCGCGACGGCGGCCTCGTGCA
CGAGCGGCTGGGTGGCGTGCGCGACGCCCTCGGCCTCCCGCTCCACCTGCTCCCGGCACGCGTCCCGTGCGCCCGGCTGAGACATGCGCTTGACGAACGC
GGCGAAGCGGCGCCAGTTGTCGGGCTGGAAAAGGTCGGGCCCCATGCGCAGGTACGTGAACGCCACCATGCGGTCCTCGGCCGCCCTGTCCGCCGCCGTG
GCCACCACCTGGTCGTGCGCCGTCTCGTCGTAGCGCGGCAGCGCGTTCTCCCCGGCCAGCCCGACGCCGGCCTCCCGCGCCGCGGCGGCCACCTGCTGCA
CCAGCGCCTCGGGGCGGCACTGCGCGTCCTGCGGCTGCTCGTGGTCCCGCATCTCGACGCACGTGAAGTTGAGCACGGCGCCGTGGCGCGCCAGCATGCG
CGCGATGGGCGCGTACCCGTCGTGCTGCCGGGTGTTGTAGTACCCCGCCGTCAGCTCCGCCGCGTGGGACCGGGTGCCGTAGTGCCAGTGGATCCCGGCC
ACCTTCACCGAGATCTTCACGCCGGGGGAGCCCGTGTACACGCCCGTCGCCGCCGACAGGATGCGCTCGCCGTGCTCCAGGAGCATCTGCGAGTACCAGC
TCATGAAGAACTGCCCGTACTCCGTGCTCCACCTGCCCTCGCGACGGAAGAAGCCCGTGTCCTCCGGCCAGTCCTTGTAGCCGCCGGAGTCGCCCGGACC
CGCGTTGCCCCACTCCGGCTTGCCCACGGCCTCAGCAGCCGCCTTCAAGCTACTCAACATGTACTGCATGAATCCACATGGATATCGCAGCAGGTCAGTT
ACAAAGCTCTGAGATTGTAGTAGAAGGGGTACCCAAAAAAAAAACGA