Detailed information on CNT30447879


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30692294Saccharum spontaneumOryza sativa17.6722.8197.891forward
CNT30224947Saccharum spontaneumHordeum vulgare18.0631.6395.793forward
CNT30652446Saccharum spontaneumRosa chinensis14.7624.697.3776forward
CNT30207452Saccharum spontaneumHelianthus annuus12.0422.2296.7762forward
CNT30722009Saccharum spontaneumTriticum spelta18.0622.295.793forward
CNT30348900Saccharum spontaneumEragrostis tef18.6420.6997.9296forward
CNT30361245Saccharum spontaneumSorghum bicolor27.7747.8386.71143reverse complement
CNT30579009Saccharum spontaneumEchinochloa crusgalli34.7638.9189.94179forward
CNT30499031Saccharum spontaneumDigitaria exilis22.1421.3194.74114forward

Expression of CNT30447879

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MRFLALKSVFLLRAHSVALDCFTNLYNLYHLEP

>peptide 2 (46 aa)
QDPCLYKSQVRGTAVTIRSVPNSPVYPPPQAETEGARARAPPPPTR*

Sequence

>CNT30447879
CCAGGACCCCTGTCTCTATAAATCACAAGTGAGAGGAACCGCCGTTACCATCCGATCCGTCCCCAACTCGCCAGTTTACCCGCCGCCGCAAGCAGAGACA
GAGGGAGCTCGTGCTCGCGCTCCGCCCCCGCCGACGCGATGAGGGCCAAGTGGAAGAAGAAGAGAATGAGGAGGCTCAAGAGGAAGCGCCGAAAGATGAG
GCAGAGATCTAAGTAGGCGCGTCTTCTGGCTGAGGAAGGGGATCGTCACCTGCACCATGGCTGCTTTGCTGTAGATGTAGGCGATGCATACAATCCTTGG
TCTTGGTTAATTCTACTAGCTCGTTGTTAAGAGTCTGGCCATGTTCTGAGACTGGGTTTATTGTAATGTGAGGATAATCATATGTTGCTTTGTGACTGAT
GTTAATGCAGTGAAATGAGATTCCTGGCACTCAAATCTGTCTTCCTGTTAAGGGCCCATTCGGTTGCTCTGGATTGTTTCACTAATTTATATAACCTTTA
TCACCTGGAACCGAA