Detailed information on CNT30447721


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30447721

Peptides detected in this lncRNA

>peptide 1 (95 aa)
MNTTIPGTGSQKENELFPDRTNAMGNGFKFFQLMHACMIRDAESLNSEGYITVAHESERGVRSHKEEQRREITGCSKENIHSQMRFRQLRCGPID*

>peptide 2 (33 aa)
MDSRGASSSPPACPCCQVTRARSAGTAVGAPRG*

>peptide 3 (49 aa)
MICFLMSPLLGYGFPWGFFLSSCLSMLPSHARAQRRNGGGRASRLREAS*

>peptide 4 (58 aa)
KEFSLMQTLFKDEHNYSRNRFTKRKRTVPRSNKCDGKRFQIFSVDARMHDSRCRKSEL*

Sequence

>CNT30447721
AAAGAGTTTAGTTTAATGCAAACTCTGTTCAAAGATGAACACAACTATTCCCGGAACAGGTTCACAAAAAGAAAACGAACTGTTCCCCGATCGAACAAAT
GCGATGGGAAACGGTTTCAAATTTTTTCAGTTGATGCACGCATGCATGATTCGAGATGCCGAAAGTCTGAACTCTGAAGGATACATTACAGTTGCACACG
AATCCGAACGAGGGGTACGTTCACACAAAGAAGAGCAGCGACGAGAGATCACCGGGTGCAGCAAAGAGAACATTCACTCGCAGATGAGATTCAGACAGCT
TAGGTGCGGCCCCATCGATTGATCCAGAATTATTTAGGACAAGTTACATTACACAGCCAAAGCAGCACAAACACACGGTCTAATCTGTACACAACCACCA
CCCATCTGCACGCTCGTCCTCCACCCCAAACACGATCCGCATGCAGGCTTCAATTAGCAACCGGCAGCTAGCCTAGAGCCTAGCAGCAAACCGGCCGGCG
GCGACGCGCGGCGGTCAAACTTGAGCAACAACTAAACAAACCATCACTTACGGGGGCTCGCTCCTACCGTCCTCCTACGCACGCGCCGTGCGTCAGTCGG
CGCGGTAGCCAGTGGCGGTGGAGTGGCCGCCGCCTCCTCCTCCGCCACCTCCACCGCCGTTGTCGCCGTTGCTGCCGCCGGTCAAGTCCTTGATGATCTG
CTTCTTGATGTCGCCCCTCTTGGGGTATGGATTCCCGTGGGGCTTCTTCCTCTCCTCCTGCTTGTCCATGCTGCCAAGTCACGCGCGCGCGCAGCGCAGG
AACGGCGGTGGGCGCGCCTCGAGGCTGAGAGAGGCTTCTTGAGTGACGGCGCGAGTGATACCTGCCTAGGCTGGCTTCTTTATACTAGAGCCAAGTCGCA
AACGCCATGTGTTCAACACAGCCTATTGGCATTGGTTTTGTGCCAGTAAAATAATTGGCCTGGGCACGACTAGTCG