Detailed information on CNT30447453


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8VZC0|UXS1_ARATH, E-value = 4e-90

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30522345Saccharum spontaneumSetaria italica72.9555.7395.69418forward
CNT30530404Saccharum spontaneumEucalyptus grandis60.9198.3184.81349forward
CNT30316147Saccharum spontaneumCorylus avellana51.6639.7384.12296forward
CNT30499549Saccharum spontaneumCoffea canephora46.2554.0879.25265forward
CNT30615836Saccharum spontaneumSesamum indicum33.3349.8782.72191forward
CNT30729539Saccharum spontaneumCorchorus capsularis58.9950.379.88338forward
CNT30524728Saccharum spontaneumPhaseolus vulgaris44.1546.8580.24253forward
CNT30486152Saccharum spontaneumOlea europaea29.6718.7881.76170forward
CNT30506399Saccharum spontaneumNicotiana attenuata38.3966.4780.91220forward
CNT30223417Saccharum spontaneumHordeum vulgare37.8795.5991.24217forward
CNT3084565Saccharum spontaneumVigna radiata37.5212.7278.6215forward
CNT30143836Saccharum spontaneumMedicago truncatula27.5727.182.91158forward
CNT30343308Saccharum spontaneumEragrostis tef47.8210090.51274forward
CNT30477892Saccharum spontaneumArabidopsis halleri31.9417.181.97183forward
CNT30570592Saccharum spontaneumVitis vinifera30.7254.4985.23176forward
CNT30579496Saccharum spontaneumEchinochloa crusgalli65.7996.4293.9377forward
CNT30499107Saccharum spontaneumDigitaria exilis68.2410093.61391forward
CNT30174824Saccharum spontaneumVigna angularis71.242.9581.13408forward
CNT30723923Saccharum spontaneumLupinus angustifolius24.4368.2985.71140forward

Expression of CNT30447453

Peptides detected in this lncRNA

>peptide 1 (32 aa)
LTSQRIGLERLKWVILLIYDKISTPMGLTWPQ*

>peptide 2 (41 aa)
MQGRRGGRSGRPLGEWVRRRRGGRARIAGCRGGARRCPCGP*

>peptide 3 (89 aa)
MGSTTSWRTSSNRGLPRWCATLSLRPVKKLSTTMTLSPRARSLSTRWLPTNPAPPVTTTRREGFRTPTGRRRAAEEAPPRGIFLATAAAK

>peptide 4 (43 aa)
MAPVALLLWMLKRITIHLTGTSQQEPGPDPLCQSKHVQGPHDI*

Sequence

>CNT30447453
CTCACATCACAGCGCATCGGATTAGAGAGACTCAAATGGGTCATACTCCTAATCTACGACAAAATTAGCACACCTATGGGATTGACATGGCCCCAGTAGC
TCTCCTTCTGTGGATGCTCAAGAGGATCACCATACACCTCACTGGTACTAGTCAGCAAGAACCGGGCCCCGACCCTCTTTGCCAGTCCAAGCATGTTCAA
GGTCCCCATGACATTTGATATGATGGTCTTGATGGGGTTGAATTTGTAGTGCACGGGGGATGCAGGGCAGGCGAGGTGGTAGATCTGGTCGACCTCTAGG
AGAATGGGTTCGACGACGTCGTGGCGGACGAGCTCGAATCGCGGGTTGCCGAGGTGGTGCGCGACGTTGTCCTTGCGGCCCGTGAAGAAGTTGTCGACGA
CGATGACGCTGTCTCCGCGGGCGAGGAGCTTGTCGACGAGGTGGCTGCCAACAAACCCCGCGCCGCCGGTGACGACGACGCGCAGGGAGGGCTTCCGGAC
GCCGACGGGGAGGCGGCGCGCGGCGGAGGAGGCGCCGCCGCGGGGGATTTTCCTGGCGACGGCGGCGGCGAAG