Detailed information on CNT30447424


BLAST search results

BLAST vs Swiss-Prot:
sp|P31853|ATPF2_SPIOL, E-value = 1e-36

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678262Saccharum spontaneumSetaria viridis24.0578.0788.76267forward
CNT30521971Saccharum spontaneumSetaria italica48.9266.9592.45543forward
CNT30703592Saccharum spontaneumQuercus lobata1025.1783.78111forward
CNT30295400Saccharum spontaneumTriticum aestivum37.8456.6890.71420forward
CNT30223111Saccharum spontaneumHordeum vulgare34.325190.81381forward
CNT30391395Saccharum spontaneumTriticum turgidum25.6847.9890.53285forward
CNT30249020Saccharum spontaneumAvena sativa11.353096.03126forward
CNT30662367Saccharum spontaneumTriticum dicoccoides37.8454.7690.71420forward
CNT30135603Saccharum spontaneumLolium perenne37.9345.1790.26421forward
CNT3016557Saccharum spontaneumZea mays29.7355.8494.55330forward
CNT30228651Saccharum spontaneumAnanas comosus23.3343.987.64259forward
CNT30653577Saccharum spontaneumRosa chinensis20.9944.2180.69233forward
CNT30683548Saccharum spontaneumTriticum urartu37.844090.95420forward
CNT30344893Saccharum spontaneumEragrostis tef15.7740.7996175forward
CNT30361586Saccharum spontaneumSorghum bicolor26.5863.1790.85295forward
CNT30579043Saccharum spontaneumEchinochloa crusgalli27.0339.6395.33300forward
CNT30115726Saccharum spontaneumOryza nivara20.0953.7393.27223forward

Expression of CNT30447424

Peptides detected in this lncRNA

>peptide 1 (81 aa)
MSSRNSVAIAGSVRLKSNSWAFSICSASAGSGAAATAAAAVASSRGSCCAKGRARRGARQPRGAERGGRQGARRADRLAQR*

>peptide 2 (40 aa)
MMAAACSSSCFTSSEASFTSPSSPRILASRSSMNLPSGVK*

>peptide 3 (50 aa)
MRSSRRCSHPPEETKPASRPGRWAFLSFSDQCVYACRAAVHGRPRPCLIL*

>peptide 4 (29 aa)
MNDNLKKSQTLYSTTHERLLDGAVFTACVG

>peptide 5 (37 aa)
MDGSPTSVYTLIRKAKERPPARPARWFGFLRRMGAPS*

Sequence

>CNT30447424
AATCCAACACAGGCGGTGAACACAGCACCATCCAGCAATCTTTCATGAGTAGTTGAGTACAGAGTCTGAGATTTCTTCAAATTATCATTCATTTATAATG
TTCATGCAATTACAGTCATAAGATAAGGCAGGGCCGCGGCCGCCCATGGACGGCAGCCCGACAAGCGTATACACACTGATCAGAAAAGCTAAGGAACGCC
CACCGGCCCGGCCGGCTCGCTGGTTTGGTTTCCTCAGGCGGATGGGAGCACCTTCTTGACGATCTCATCGCTGAGCGAGGCGATCTGCGCGTCGAGCGCC
TTGACGGCCTCCTCTTTCTGCGCCTCGAGGTTGGCGAGCGCCTCGACGAGCTCGGCCTCCACGCGGCTGCGGCCCTCCTCCAGCTTGGCCTCCAGCTCCG
CGGTGGTCTCCTTCTTCATCTTGTTGAGCGCCGCCGCTATCTCGGCGCGCGCCGCCTTCATGATGGCGGCCGCCTGCTCCTCCAGCTGCTTCACCTCCTC
GGAGGCGTCCTTCACGTCGCCGAGCTCGCCGCGGATCTTGGCGTCCCGCTCGTCCATGAACTTGCCCAGCGGCGTGAAGTAGAGCTTGTCCAGCGCCACC
ATGAGCAGCAGGAACTCGGTCGCGATCGCCGGGAGCGTCAGGTTGAAGTCGAACAGCTGGGCTTTCTCCATCTGCTCCGCCAGCGCCGGGAGCGGCGCGG
CCGCCACCGCCGCCGCCGCCGTCGCCAGCAGCCGCGGGAGCTGCTGCGCCAAGGGCCGAGCTCGTCGAGGCGCTCGCCAACCTCGAGGCGCAGAAAGAGG
AGGCCGTCAAGGCGCTCGACGCGCAGATCGCCTCGCTCAGCGATGAGATCGTCAAGAAGGTGCTCCCATCCGCCTGAGGAAACCAAACCAGCGAGCCGGC
CGGGCCGGTGGGCGTTCCTTAGCTTTTCTGATCAGTGTGTATACGCTTGTCGGGCTGCCGTCCATGGGCGGCCGCGGCCCTGCCTTATCTTATGACTGTA
ATTGCATGAACATTATAAATGAATGATAATTTGAAGAAATCTCAGACTCTGTACTCAACTACTCATGAAAGATTGCTGGATGGTGCTGTGTTCACCGCCT
GTGTTGGATT